KEGG   Hahella chejuensis: HCH_06466Help
Entry
HCH_06466         CDS       T00307                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hch  Hahella chejuensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCH_06466 (bchI)
Enzymes [BR:hch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HCH_06466 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6600071..6601807
Genome map
AA seq 578 aa AA seqDB search
MDVAAQAAPAAYPFAAVVGQQPLKTALLLAAINPHLGGVLISGPRGSAKSTLARGLADLL
PEAADKFVTLPLGASEERLIGSIDLQQAMGERRVQFNPGLLAKAHGGVLYIDEVNLLPDP
LVDALLDTAASGVNFVERDGLSHSHPAQFILIGTMNPDEGELRPQLQDRFGLAVTLDETY
DVEQRMAIVERRLAFEQDRNAFRAQWRDAQRELKSRIAAARERLPQVLCPTDIQRDIASQ
CLAASVEGVRADICWRRAAIAHAAWNGRDEVSVEDVAATRSFALSHRAKHQDTPPPPTGA
APPQGGGSANSGGDSSSSSSSGTAGDWGGMPPQRMAADKPVTPQLPEIPTLRSPSSRRDT
QRGGAEQRQGSALGRAQRSWQALSSRPDWFATLVHPDNRDDGLREIRYQPRRHSRDTLNC
VLLDTSASTLSQRALAQAKGVILGLARQAYLAREKLAVLAFGAQRTEWVIPCRRAPKDIA
ALLNELPAGGGTPLRQALLHARQLLARQTRANPHLTCRTLLLTDGRSRDPLDDLIWGSPL
WVVDTEQTAVRLNRCRQLAQRLGAAYAPLAAVRAALEH
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgccgcccaggctgcccccgccgcctaccctttcgccgcggttgtcggccag
cagccgctgaaaaccgcattgctgctcgccgccatcaatcctcatctgggcggcgtcttg
atcagcggtccgcgcggctccgccaaatcgacactggcgcggggactggcggatctgctg
ccggaagcggcggacaaattcgtcactctgcccctgggcgcttcggaagagcgcctgatc
ggcagcattgacctgcaacaggctatgggcgagcgacgcgtgcagtttaaccccggcctg
ttggccaaagctcacggcggcgtgctttatattgatgaagtcaatttgctgcccgacccc
ttggtggacgccctgctcgacacggcggcctcgggcgtgaactttgtcgagcgggacggc
ctcagtcacagccatccggcgcagtttattctgatcggcaccatgaacccggatgaaggc
gaactgcgtccgcagctacaggaccgtttcggtctcgcggtcacgctggatgaaacctat
gacgtggaacagcgcatggctattgtggagcggcgtctggccttcgaacaggatcgcaac
gcgtttcgggcgcaatggcgcgatgcgcaacgagagctgaaaagccgcatcgccgccgcc
cgcgaacgcctgccgcaggttctctgcccaacagatatacaacgggatatcgccagccaa
tgcctcgccgccagcgtagaaggcgtgcgcgcggacatttgctggcgccgcgccgccatc
gcccacgccgcctggaacggacgcgacgaggtcagcgtggaagacgtagcggcgacgcgt
tcgttcgcgcttagccatcgcgccaaacatcaggacacaccccctccccccactggcgcc
gcgccccctcaaggtggcggaagcgccaacagtggaggagattcatcttcttcgtcatct
tccggaaccgccggcgactgggggggcatgccgccgcaacggatggcggcggacaagcct
gtgacgccacaactgcccgagatcccaacgctacgttctccgtcctctcgtcgcgacaca
cagcgcggcggcgcggaacaacgacaaggttcggccctcggtcgcgcgcaacgcagctgg
caggcgctgtcctcacggccggactggttcgccacgctcgtccaccccgacaatcgggac
gacgggttgcgcgaaatacgctatcaaccccgtcgccacagtcgcgacaccctgaactgc
gtcctgctggacacctccgcctccaccctgagtcaacgcgcgctggcgcaggcgaaaggg
gtgattctgggattggcccgacaggcctacctggcgcgggagaaactggccgtgctggcg
tttggcgcgcagcgcacggagtgggtgataccctgccgacgcgcccccaaagatatcgcc
gccctgctcaacgaacttcccgctggcggcggtacgccgctgcgacaggcgctgctgcat
gcgcgccaactgctggcgcgacagacccgcgccaacccgcatctgacctgccgtacgttg
ctgctgactgacgggcgcagccgcgatccgctggacgatctgatttggggttcgcccctg
tgggtggtggataccgaacagaccgccgtcagacttaatcgctgccgacaactggcgcaa
cgcctcggagccgcttacgccccgctggccgccgtgcgcgccgccctggaacactaa

DBGET integrated database retrieval system