KEGG   Hahella chejuensis: HCH_06958Help
Entry
HCH_06958         CDS       T00307                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hch  Hahella chejuensis
Pathway
hch00260  Glycine, serine and threonine metabolism
hch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01130  Biosynthesis of antibiotics
hch01230  Biosynthesis of amino acids
Module
hch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_06958 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCH_06958 (trpB2)
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCH_06958 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABC33574
UniProt: Q2S700
Position
7072602..7073882
Genome map
AA seq 426 aa AA seqDB search
MIRSNNGMFGSFGGRYAPEILTPALIELERLFFSLRDDPDFWREYQTLAQQFSGRPTPLT
PCERLSREIGGAQIWLKREDLNHSGAHKVNNVLGQGLLVRRMGKRRVIAETGAGQHGLAT
AIMAARLGLECRIYMGEDDIERQYGNVFWMRRLGAEVIPVATGARTLKEAMDEALRDWAA
SFEDTHYVLGTACGPAPFPELVAYFQSIIGKELQQQALSQIGRNPDSVVACVGGGSNALG
AFAPFIERHDVELVGVEAGGRSREEGQHSIRLQEGTGEDGIAQGFKTLFLQDADGQLGHT
HSVAAGLDYVGVSPILADLTQRGRLTPDSATDEEALAAFETLLRYEGIIPALESSHALAG
GFRRAAQMSPQQHMVINLSGRGDKDIFNVARAFPHPDWSAFLQRELARQPDFTTQTTQGE
SATDVA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcagcaacaacggtatgttcggcagctttggcggccgttacgccccggaaata
ctgacgccagctctaatagagctggaacgcctatttttcagtttgcgcgacgatcctgac
ttctggcgagaatatcagaccctggcgcagcaattcagcggcagacccactcctctcaca
ccctgcgagcgtctgtcccgggaaattggcggcgcgcagatctggttgaaacgggaagac
ctcaaccactccggcgcccacaaagtgaataacgtactgggacaaggtttgctggtgcgc
cgcatgggcaaacgcagagtgatcgccgaaaccggcgccggacagcatggactcgccact
gcgatcatggctgcccgtttgggccttgagtgtcgtatttacatgggcgaggacgacatt
gagcgtcagtacggcaatgtgttctggatgcgccgcctgggcgcggaagtcattcccgtc
gccaccggcgcacgcactttgaaagaagccatggacgaggcgttgcgcgattgggccgcc
agttttgaagacacccactacgtgctcggcaccgcctgcggacctgcgcctttcccggag
ctggtagcttatttccagagcattatcggcaaggagttacagcaacaggcgctgtctcaa
atcggtcgtaatccggacagcgtcgtggcctgtgtcggcggcggcagcaacgccctgggc
gcattcgcgccctttattgagcggcacgatgtcgaattggtaggcgtggaagccggcgga
cgcagtcgcgaggagggtcagcactctattcgcctgcaagaaggaaccggcgaagacggc
atcgcccaaggcttcaaaacgctgtttttacaggacgccgacggacagcttggacacacg
cacagcgtggcggcgggactggattacgtcggcgtatcgccaatcctggccgacctcacc
caacgcgggcgattaacgccagattccgcaaccgacgaggaagcattggcggcgtttgaa
acgttattgcgatatgagggcatcatcccggcgctggaatcctcccacgcactggcgggc
gggttccgccgcgcagcgcaaatgtccccgcagcagcatatggtgataaacctgagcgga
cgcggcgacaaggacattttcaacgtggcccgcgccttccctcatccagattggtccgcc
ttcctgcaacgcgagttggcgcgtcagcctgacttcacaacgcaaacaactcaaggggag
agcgccaccgatgttgcctga

DBGET integrated database retrieval system