KEGG   Hahella chejuensis: HCH_06959Help
Entry
HCH_06959         CDS       T00307                                 

Gene name
trpA2
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hch  Hahella chejuensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCH_06959 (trpA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_06959 (trpA2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCH_06959 (trpA2)
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCH_06959 (trpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7073872..7074651
Genome map
AA seq 259 aa AA seqDB search
MLPERKPEELLVMSHAVVGYPSLEANLPAIDALVVAGVKMIELQIPFSDPVADGPTLAHA
CHVALKNGGGVKQALALAAQVSRRHPQVSFLLMSYLNPLYRYGLDRLFTDAAEAGVKGLI
IPDLPVEALEPHLPLLDKLGLAPIMMVTPVTPPERLQRISNAARGMLYVVARTGVTGSQT
RWDAEFDEYIARLRGYTTLPLAVGFGVRSAEDLRQLRGRVEVAAVCSRYIEWQGELGGEA
AAERMAELCEAAGAIPAMA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctgaaagaaaaccagaagagctgttagtgatgtcccacgcggtggtgggctac
ccctctcttgaggccaacctgccggcgattgatgcattggtcgtcgccggggtgaaaatg
atcgaactgcaaattccgttcagcgacccggtggcggacggcccgacactggctcacgcc
tgccatgtcgccctcaagaatggaggcggcgttaaacaggcgctggcgttagcggcgcaa
gtgtcacgacgtcacccacaggtgagctttctgttaatgagctacctcaaccctctctac
cgttacggtcttgatcgcttattcaccgatgcggccgaagctggcgtgaaagggctgatc
ataccggacctgcctgtggaagcgctggagccgcatttacccctgctggataagcttggg
ctagcgccaatcatgatggtgacgcccgttacccccccggaacgtctgcaacgcattagc
aacgccgcgcggggcatgctctacgtggttgcccgcaccggcgtcaccggctcccaaacc
cgctgggacgctgagttcgatgaatatattgcgcgactcagaggctataccactctgcct
ctcgcagttggctttggtgtgcgtagcgctgaggatttgcgtcaactgagaggacgggta
gaagtagcggcggtctgttcccgttacatcgagtggcaaggcgaactcgggggagaggct
gccgctgagcgtatggcggaattatgcgaagcggcgggcgccattccagcgatggcgtaa

DBGET integrated database retrieval system