KEGG   Candidatus Hodgkinia cicadicola Dsem: HCDSEM_101Help
Entry
HCDSEM_101        CDS       T00938                                 

Gene name
hisD
Definition
(GenBank) histidinal/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hci  Candidatus Hodgkinia cicadicola Dsem
Pathway
hci00340  Histidine metabolism
hci01100  Metabolic pathways
hci01110  Biosynthesis of secondary metabolites
hci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hci00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HCDSEM_101 (hisD)
Enzymes [BR:hci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HCDSEM_101 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF2919
Motif
Other DBs
NCBI-ProteinID: ACT34285
UniProt: C6UN35
Position
73047..74333
Genome map
AA seq 428 aa AA seqDB search
MSLRLRSDSPGFGEFVKGVIASRARVSARVKAVAEKISQTVSAYADKALMAYNLRLDGCA
SRLLRFAPDIDLETVDVKALFSLKLALDRVAALHSLQLPSSCCVRDALGAKLGFRWTPVS
SVGVYVPGGTASYLSSVIMCCVPARIAGVGHISLATPYSKLANKPLFMACAKLCGVACVY
PFGGAHAVAALSVGTRAVRKVDKIVGPGNAFVAAAKALAQGRVGVDCLAGPSEAVIVADG
VADAWTLAVDSLCQLEHASDALTAVVVSSAELASRVRANVALLVRSARRRRTAERSWSAG
GVSVVCCCVADAAATVNALASEHVQACVLKPAKLLTKLTSAGAVFLGGGSPIVVGDYVGG
TNHTLPTASGAKFASGLSVLDFMKRTYVTWLPTARPMLALAPACAACASAEGLSCHALAS
ASRLWRRR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttaaggcttaggtcagactcgcctggttttggcgagtttgttaaaggcgtcata
gctagccgagcgcgcgttagcgcacgcgtgaaagctgtggctgaaaaaatttctcaaaca
gtgtcggcgtacgccgacaaggcgctgatggcgtacaaccttaggctcgacggctgcgca
agcaggctgttgaggtttgcgcccgacatcgatctggagactgtggacgtgaaagcgctg
tttagcttgaagctggcgcttgacagagtggctgcgctgcacagccttcagctgccgtca
agctgctgcgttagggacgcgttgggcgctaagcttggttttaggtggacgcccgtgtcg
agtgttggtgtttacgtgcccggaggcacggctagctaccttagcagcgttataatgtgc
tgcgtgccggctagaattgctggcgtcggtcacatcagcttggccaccccttattctaag
ctggctaacaagcctttgtttatggcttgcgccaagttgtgtggtgtggcgtgcgtgtat
ccgtttggcggcgctcacgccgtggctgcgctttcagttggcactcgcgccgttcgcaaa
gttgacaagattgtggggccgggcaacgcgtttgtggctgcggccaaagcgctagcacag
gggcgagtgggggttgactgcttggctgggccgtcggaggctgtgattgttgccgacggt
gtcgccgacgcgtgaacactggctgtcgacagcttgtgccagctggagcacgccagcgac
gcgctgacagctgttgtagtaagcagcgctgagctggcttcgcgtgtgagagctaacgtg
gcgctgcttgttcggtctgcgcgccggcggcgtacggctgaacgcagctgaagcgccggc
ggcgtcagtgtggtgtgttgttgtgtggctgacgccgcggctacggttaacgcgctggct
tcggagcacgtgcaagcttgcgttctcaaacctgcaaagctgctcaccaagcttacatcg
gctggtgctgtgtttctaggtggcggctctccgattgtggtcggagactacgttgggggc
acaaaccacacgctgcccaccgcgtctggcgccaagtttgcgtccgggctgtcggtgctg
gactttatgaagaggacgtacgtcacttggctgccgactgcgcgcccaatgctggcgctg
gcgccagcgtgcgctgcgtgcgcgtccgctgaaggcttgtcgtgtcacgctctggcatcg
gctagcaggctgtggcgccgacgctag

DBGET integrated database retrieval system