KEGG   Candidatus Hodgkinia cicadicola Dsem: HCDSEM_123Help
Entry
HCDSEM_123        CDS       T00938                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
hci  Candidatus Hodgkinia cicadicola Dsem
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hci00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HCDSEM_123
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HCDSEM_123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90264..90875
Genome map
AA seq 203 aa AA seqDB search
MIALCGALRARGWRFVIASAYADLRVGIRYARLACTAVLCFMLLVTPFAVLSASLHPDLS
YAKAVRPPLRARTRRARRRPELKTLFVTASAARGERFYSACAGCHTPGRGQPHGVGPNLW
GVVLRRVAAVPSYAYSSALRSLSTSRWGLEALNKFLKRPNEYAPGTYMTFSGVSSPAERM
DVLRYLGSLSDAPMNVARFRFRR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgttgtgtggcgcgttaagagcgcgaggctggcgctttgttatcgcgtcggcg
tacgccgacctgcgcgtcggcattaggtatgctaggcttgcgtgcaccgcggttttgtgt
tttatgctgctggtgacgcccttcgccgtgctgtctgctagcttgcaccccgatctgtct
tatgcaaaagctgtgcgcccgcctctgcgggcgcgaactaggcgcgcgcgccgccggcct
gagcttaaaacgctgtttgttacggcgtcggcagctagaggtgagcggttttatagcgcg
tgcgccggctgtcacacgccgggcaggggccagcctcacggcgtcggccccaatctttga
ggcgtggtgctgaggcgcgtggcggctgtgccaagctacgcttactcgtcggcgctgcgt
agcttgagcacttcaaggtgggggcttgaagcgcttaacaagtttttgaagcgaccaaac
gagtacgcgccgggcacctacatgacgttttcaggagttagcagccccgccgagagaatg
gacgtgcttcgctaccttggctcgctgtctgacgcccccatgaatgttgcgcgcttcagg
ttcaggcgctag

DBGET integrated database retrieval system