KEGG   Helicobacter cetorum MIT 99-5656: HCD_00480Help
Entry
HCD_00480         CDS       T02033                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_00480
   00030 Pentose phosphate pathway
    HCD_00480
   00051 Fructose and mannose metabolism
    HCD_00480
   00052 Galactose metabolism
    HCD_00480
   00500 Starch and sucrose metabolism
    HCD_00480
   00520 Amino sugar and nucleotide sugar metabolism
    HCD_00480
  Nucleotide metabolism
   00230 Purine metabolism
    HCD_00480
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCD_00480
Enzymes [BR:hcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HCD_00480
    5.4.2.8  phosphomannomutase
     HCD_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
99276..100664
Genome map
AA seq 462 aa AA seqDB search
MDTNIFREYDIRGIYPKTLDENIAFSIGVELGKIMQQYSKGVFVGYDARVHGKNLFEALS
AGLQQEGLKVYDLGLIPTPVAYFATFNEIDSIQCPNSIMITGSHNPKEYNGFKITINNNP
FYGKDIQALKDTLLNATQNATYKIKPLKEMPLKVNALEAYHNYLINNFKHLKDFKHKIAL
DFGNGVGALGLVPILKALNIDFDSLYSEPDGNFPNHHPDPSETKNLQDLKAHMQENAISI
GFAFDGDADRIAMLGANHIYAGDELAILFAKHLYNQGITPFVIGEVKCSQVMYDTINSFG
KTLMYKTGHSNLKVKLKETTAHFAAEMSGHIFFKERYFGYDDALYACLRALELMLKEDPS
DLKNFIKNLPYSYTTPEEKIFVSEEEKFEIIQNLQNKLQNVPDNFPKIKEIISIDGVRVV
FEHGFGLIRASNTTPCLVTRFEGKDEKTALEYKKALLGLLDG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaatatttttagagaatatgacattaggggcatttatccaaaaactttagat
gaaaatatcgcttttagtatcggcgtagagttaggaaaaatcatgcaacaatatagcaag
ggcgtatttgtgggctatgatgcaagggtgcatggaaaaaacctttttgaagctttgagt
gcaggattacaacaagagggtttaaaagtgtatgatttggggcttattcctacaccggtg
gcgtattttgcgacctttaatgagatagatagcattcaatgccctaactccattatgata
actggctctcataaccctaaggaatataacggctttaaaatcacaatcaataacaaccct
ttttatggcaaggatattcaagctttaaaagacacgcttttaaatgccacacaaaacgcc
acatataaaattaaacccctaaaagaaatgcctttaaaagtcaatgccctagaagcttat
cacaactatttaatcaacaattttaagcatttaaaagatttcaagcacaaaattgcccta
gattttggtaatggcgtgggagcgttaggcttagtgcctattttaaaagctttaaacatt
gattttgatagtctttatagtgagcctgatggcaattttcctaaccaccacccagaccca
agcgagactaagaatttacaagacttgaaggcacatatgcaagaaaatgctatttctata
ggctttgcttttgatggcgatgcggataggattgcaatgctaggggctaatcatatttat
gcaggcgatgaattagccatattatttgctaagcacttatacaatcaaggcattacccct
tttgtgataggtgaagtcaaatgctctcaagtgatgtatgacactatcaatagttttggc
aagacgctgatgtataaaaccgggcatagcaatttaaaagtcaagcttaaagaaacaact
gcgcattttgcagccgagatgagcgggcatatcttttttaaagagcgttattttggctat
gatgatgccctttatgcgtgtttaagagccttagaattaatgcttaaagaagacccaagc
gatttaaaaaacttcattaaaaatctcccctattcttacaccacgcctgaagaaaaaatc
tttgtgagcgaagaagaaaaatttgaaatcattcaaaatttacaaaacaaacttcaaaat
gtgccagataacttccctaaaatcaaagaaattatcagtattgatggcgtgagagtggtt
tttgaacatggttttggacttattcgtgcgagtaacaccaccccatgtctagtcactcgc
tttgaaggcaaagatgaaaaaacggcgttagagtataaaaaggcgttgttaggattattg
gatgggtaa

DBGET integrated database retrieval system