KEGG   Helicobacter cetorum MIT 99-5656: HCD_00560Help
Entry
HCD_00560         CDS       T02033                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00260  Glycine, serine and threonine metabolism
hcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01130  Biosynthesis of antibiotics
hcm01230  Biosynthesis of amino acids
Module
hcm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCD_00560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCD_00560
Enzymes [BR:hcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCD_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFI05144
UniProt: I0EQC5
Position
114115..115296
Genome map
AA seq 393 aa AA seqDB search
MNKNAYFGEFGGSFVSELLVPALRELELAFYDSLNDSEFQKEYARLLKDFVGRPSPLTLC
KNIISNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATALA
CALLQLECVIYMGAKDIKRQEPNVFRMRLLGAKIISVTQGSATLKDAVNEALRDYATNYK
NTHYLLGTAAGPHPYPTMVKTFQSMIGTECKAQILEKENRLPDYVIACVGGGSNAIGIFN
AFLEDKEVKLIGVEPAGLGLDTNKHGATLNKGSIGILHGNKTYLLQDSEGQITESHSISA
GLDYPGVGPEHSYLKDSKRATYESATDNEALEAFSLLCQKEGIIPALESSHALAYALKLA
KKCDKESVIVVNLSGRGDKDLNTVANALKREIK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgcgtattttggggagttcggggggagttttgtttcagaattattagtg
cctgcacttagagaactagagcttgctttttatgatagcttgaatgatagcgaatttcaa
aaagaatatgcaaggctattaaaagattttgtaggtcgccctagccctttaactttgtgt
aaaaatattatttctaatcctaaagtaaaactttatctaaaacgagaggatttaattcat
ggcggagcgcataagactaatcaagccttagggcaagcccttttagccaaaaaaatgggc
aaaacacgaattatcgcagaaactggtgctggacaacacggcgtagctacagccctagcg
tgtgcgttattgcaattagaatgcgtgatttatatgggggctaaagatataaaacgacaa
gagccaaatgtttttagaatgcgtttattaggggcaaaaatcatcagcgtaacgcaaggc
tcagctacgcttaaagacgccgtgaatgaagccttaagagactatgcaactaactataaa
aacacgcattacttgctaggcacggccgctgggccacacccatatcctacaatggttaaa
acttttcaaagcatgattggcactgaatgtaaggctcaaattttagaaaaagaaaatcgc
ctacctgattatgttatagcgtgtgtaggagggggttctaatgctatagggatttttaat
gcgtttttagaagataaagaagttaaactcataggcgtagagccagcgggacttggacta
gatacaaataagcatggagcgactttaaataaggggagtataggcattttgcatggcaat
aaaacttatctcttacaagatagtgaaggtcaaatcacagaaagtcatagcattagtgca
gggctagattatccgggtgtggggccagagcatagttatctcaaagatagtaagcgtgct
acctatgagagtgctactgataatgaagctttagaagcgtttagcttgttgtgtcaaaaa
gaaggcattattccagcactagaaagctcacacgccttagcatatgcgttgaaacttgct
aaaaagtgcgataaagagagcgttattgtagtgaatttaagtggtaggggcgataaggat
ttaaacaccgttgctaacgccctaaaaagggagattaaatga

DBGET integrated database retrieval system