KEGG   Helicobacter cetorum MIT 99-5656: HCD_00565Help
Entry
HCD_00565         CDS       T02033                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00260  Glycine, serine and threonine metabolism
hcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01130  Biosynthesis of antibiotics
hcm01230  Biosynthesis of amino acids
Module
hcm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCD_00565 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCD_00565 (trpA)
Enzymes [BR:hcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCD_00565 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: AFI05145
UniProt: I0EQC6
Position
115293..116081
Genome map
AA seq 262 aa AA seqDB search
MRYSQVFKTLEQENKPAFIPFVTLGDPNYEWSFEIIKTLIDSGVSALELGFGFSDPVADG
AIIQASNLRALKHAKMDKNFKLLKEIREYNAHIPIGLLVYANLIVAFGIEKFYATAKECG
VDSILIADMPLIEKELVEKHAKKHEIKQVFIASPNANLKDLEQIANHSQGYIYTLARSGV
TGASNTLENDATNIIKTLKSLCATPCLLGFGISKKEHVKNARDMGASGVICGSALVKIIE
ENLSNKNAMLEKIKGLVEEMMK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagatactcacaagtttttaaaacattagagcaagaaaataaacccgcttttattcct
tttgtaaccttaggcgaccctaattatgaatggagttttgagattatcaaaacactcatt
gatagcggtgtgagtgccttagaactaggctttggcttttctgaccctgtagctgatgga
gccataatacaagcgagtaatttaagggcattaaaacacgctaaaatggacaaaaacttt
aaacttctcaaagagattagagagtataacgctcatattcctatcgggcttttagtatat
gcgaatttaattgtggcttttggaatagaaaaattttatgccacagctaaagaatgtggt
gtggatagcatcttaatagcggatatgcctttaatagaaaaagaattagtagaaaaacac
gctaaaaaacacgaaatcaaacaagtttttatcgctagtcctaacgcaaatcttaaagac
ttagaacaaatcgctaatcattcgcaaggctacatctacaccttagctagaagtggggtt
actggtgcgagcaatacgctagaaaatgacgccactaacattatcaaaaccttaaaatcc
ctttgtgctaccccatgcctattaggctttggcatttctaaaaaagagcatgtgaaaaat
gctagagatatgggagcaagtggcgtgatttgtggctcagcattagtaaaaattatagaa
gaaaatttgagtaacaaaaacgctatgttagaaaaaattaaggggcttgtagaagagatg
atgaaatga

DBGET integrated database retrieval system