KEGG   Helicobacter cetorum MIT 99-5656: HCD_00780Help
Entry
HCD_00780         CDS       T02033                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hcm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158597..159388
Genome map
AA seq 263 aa AA seqDB search
MLCCFEAYPKINIFLKILQKEGTYHKLISRMCLVKDKLKDTISIKNAPSFSLKGNFDCPI
EENSLFKALQALKNFLKQKNFSNSLVKSLDTLAIEAEKNIPTQAGLGGGSADAGGLIYHL
NEVFELQLSLEELYSIGSLVGADTNFFISQYQSANATSYGEVIEPFKEDSLTNRIEIYVP
NNISCSTKAIYQAYSPKTCFSQTHMWLEKPSLECLNTYHRSELNDLLEPALLTHPTLKNI
ESELGNEWFFSGSGSAFFRLKRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctttgctgttttgaagcctatcctaaaatcaacatttttttaaagattctccaaaaa
gaagggacttatcacaaactcatctctcgcatgtgcttagtaaaagacaaactaaaggac
actatcagcattaaaaacgcaccatctttttcactcaaaggaaattttgattgccccata
gaagaaaactcgctttttaaggctctccaagcgctaaaaaattttttaaagcaaaaaaac
ttctcaaattctcttgtaaaatctctagatactctggcgattgaagcggaaaaaaacatt
cctactcaagctggattaggcggtgggagtgctgatgctggggggcttatctatcatttg
aatgaagtttttgagctgcaactaagcttagaagagctttattctatcggttctttagtg
ggtgcggatacaaacttcttcatctcacaatatcaaagtgcgaatgcgacttcttatggc
gaagtcattgaaccatttaaagaagactctttaacaaatcgcatagaaatctatgtgcct
aacaatatttcttgtagcacaaaagctatctatcaggcctatagccctaaaacttgtttc
tctcaaacgcatatgtggcttgaaaaacctagtttagaatgcttaaatacctaccacaga
agcgaacttaacgaccttttagagccagccctactcacgcaccccaccctaaaaaacata
gagagcgaactaggtaatgagtggttttttagtgggagtgggagtgcgttttttaggcta
aagcgtgcttaa

DBGET integrated database retrieval system