KEGG   Helicobacter cetorum MIT 99-5656: HCD_00780Help
Entry
HCD_00780         CDS       T02033                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00900  Terpenoid backbone biosynthesis
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCD_00780
Enzymes [BR:hcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HCD_00780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N DUF4778
Motif
Other DBs
NCBI-ProteinID: AFI05188
UniProt: I0EQG9
Position
158597..159388
Genome map
AA seq 263 aa AA seqDB search
MLCCFEAYPKINIFLKILQKEGTYHKLISRMCLVKDKLKDTISIKNAPSFSLKGNFDCPI
EENSLFKALQALKNFLKQKNFSNSLVKSLDTLAIEAEKNIPTQAGLGGGSADAGGLIYHL
NEVFELQLSLEELYSIGSLVGADTNFFISQYQSANATSYGEVIEPFKEDSLTNRIEIYVP
NNISCSTKAIYQAYSPKTCFSQTHMWLEKPSLECLNTYHRSELNDLLEPALLTHPTLKNI
ESELGNEWFFSGSGSAFFRLKRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctttgctgttttgaagcctatcctaaaatcaacatttttttaaagattctccaaaaa
gaagggacttatcacaaactcatctctcgcatgtgcttagtaaaagacaaactaaaggac
actatcagcattaaaaacgcaccatctttttcactcaaaggaaattttgattgccccata
gaagaaaactcgctttttaaggctctccaagcgctaaaaaattttttaaagcaaaaaaac
ttctcaaattctcttgtaaaatctctagatactctggcgattgaagcggaaaaaaacatt
cctactcaagctggattaggcggtgggagtgctgatgctggggggcttatctatcatttg
aatgaagtttttgagctgcaactaagcttagaagagctttattctatcggttctttagtg
ggtgcggatacaaacttcttcatctcacaatatcaaagtgcgaatgcgacttcttatggc
gaagtcattgaaccatttaaagaagactctttaacaaatcgcatagaaatctatgtgcct
aacaatatttcttgtagcacaaaagctatctatcaggcctatagccctaaaacttgtttc
tctcaaacgcatatgtggcttgaaaaacctagtttagaatgcttaaatacctaccacaga
agcgaacttaacgaccttttagagccagccctactcacgcaccccaccctaaaaaacata
gagagcgaactaggtaatgagtggttttttagtgggagtgggagtgcgttttttaggcta
aagcgtgcttaa

DBGET integrated database retrieval system