KEGG   Helicobacter cetorum MIT 99-5656: HCD_02185Help
Entry
HCD_02185         CDS       T02033                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hcm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453363..453977
Genome map
AA seq 204 aa AA seqDB search
MHSATNLLILSGPSGAGKSTLTKYLQENISQIYFSISTTTRKQREGEINGLHYHFVSEEE
FKLGIEKGQFLEWAIVHNHYYGTSKLPVEKALKEGQIVIFDIDVQGHRDIKKHYPNACSV
FINTKNQEILKERLLLRGTDSKETIEKRLVHAYNEMQFLESFDYLIINDNLEKSKDAILS
IAKTLAYRKKAFNFEKVLRVWKND
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtgcaactaatttgctgattctttcaggtcctagtggggctggaaaaagcacc
cttaccaaatatttacaagaaaatatctctcaaatctatttttctatttctacaaccact
cgcaaacaaagagaaggcgagattaatggattacactatcattttgtcagcgaagaagag
tttaaactaggcatagaaaaagggcaatttttggaatgggctattgtgcataatcattac
tatggcacatctaaacttcctgtagaaaaagccttaaaagaagggcaaatcgttattttt
gatattgatgtgcaagggcatagagacatcaaaaagcactatcctaacgcatgctcagtg
tttatcaacactaaaaatcaagagattttaaaagaacgcttgcttttaagaggaacagat
tctaaagagaccatagaaaagcgattagttcatgcctataatgaaatgcagtttttagaa
agctttgattatctcattataaacgacaatttagaaaaatctaaagatgcaatattaagc
attgctaagactttagcctatcgcaaaaaagcgtttaattttgaaaaagtcttaagagtt
tggaaaaacgactag

DBGET integrated database retrieval system