KEGG   Helicobacter cetorum MIT 99-5656: HCD_02335Help
Entry
HCD_02335         CDS       T02033                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCD_02335
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCD_02335
Enzymes [BR:hcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HCD_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(490986..491540)
Genome map
AA seq 184 aa AA seqDB search
MQEIKILENLQKSLTLKESMLSYEMLGKSLSYNPYLPRAISKTKDYVFLTPGEIREKLLN
ESIDTECVIVNFKKLYEVGVPSVFDLEILGLLRRHASSFIIHDDFLMSHYQLLESVIQGS
DGVILDEMLLKEDLKDMIEFALRLGLSVFVETKKASESLKALGVLAVLEKAPNSQNKKKI
VFLD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaagattttagaaaatttacaaaaaagcttgaccttaaaagagagcatg
ctctcttatgagatgttaggcaaaagcttgtcgtataatccttacttacctagagccatc
tctaaaactaaggactatgtttttttgacccctggtgagattagagaaaagcttttaaat
gaatctatagacacagaatgtgtcattgtcaattttaaaaaattgtatgaagtgggtgtg
ccaagcgtatttgatttagaaatcttagggttattacgccgtcatgcaagctcttttatt
atccatgatgattttctaatgagccattaccagcttttagaatccgttattcaaggttct
gatggggttattttagatgaaatgcttttaaaagaagatttgaaagatatgatagaattt
gctttgcgtttggggctaagcgtttttgtagagactaaaaaggctagtgaaagcttaaaa
gcgttaggggttttagctgtgttagaaaaagctccaaattctcaaaataagaaaaaaata
gtctttttagattga

DBGET integrated database retrieval system