KEGG   Helicobacter cetorum MIT 99-5656: HCD_02540Help
Entry
HCD_02540         CDS       T02033                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(530884..531513)
Genome map
AA seq 209 aa AA seqDB search
MKSIKNRLMCEEINKRFSLHAKVRKAMESIEREIFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEVDNVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLFLEARSRIKAL
GLENIHIKLADGNKGWEQYAPYDRILFSACAKNIPQALIDQLEEGGIIVAPIQENNEQVI
KRFVKKNNTLCVQKVLEKCLFVPVLDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagtataaaaaatcgcttgatgtgtgaagaaatcaataagcgtttcagtttgcat
gcaaaagtaagaaaagctatggaaagcattgagagagaaatctttgtgccagcccctttc
aaacattttgcctataccttgaatgccctgtccatgcaagcacaacaatatatttcttca
cccttgaccgtggcgaaaatgacacaatatttggaagtggataatgtggatagtgtgcta
gaaattggctgtgggagtggctaccaggcggcggtgttgtctcaaatttttaggcgcgta
tttagcattgaaaggattgaaagcttgtttttagaagcacgctcacgcattaaagcttta
ggtttagagaatattcatattaagcttgctgatggcaataagggctgggagcaatacgcc
ccttatgataggattttattttccgcttgcgctaaaaatattccgcaagctctcattgac
cagcttgaagaaggcggaatcatcgttgcccccatacaagaaaataacgagcaagtgata
aaacgctttgtaaaaaaaaataacaccttgtgcgttcaaaaagtgttagaaaaatgcttg
tttgtgccagtgctagatggggtgcaataa

DBGET integrated database retrieval system