KEGG   Helicobacter cetorum MIT 99-5656: HCD_04765Help
Entry
HCD_04765         CDS       T02033                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hcm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hcm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995880..996806
Genome map
AA seq 308 aa AA seqDB search
MILVGLEAELGASKKGTNEGVRRLREALSNTHGELVKNMHMIIQERCVLNKEFRYAKNFE
DYYAFCKEILIPHMQEVFERKEFSLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSGHIHGMPLGMVLNRVHSGFNSMNKSEEKAWQELCALGLEKGGLEINPKNIV
YFGVRSTEQSERDVIEELQIPLFSVNDIKENMQEVVQKAKELLKEVDIIYLSLDVDIMDG
KLFTSTGVRENGGLSFQELRQFLSLLLETFKDKLGALEVTEYNPLVGAKDEEEQVLEILR
LVIDSCKG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattttagttggattagaagccgagttaggggcgtcaaaaaaaggcacaaatgagggg
gttaggcgtttaagagaagctttaagcaacacgcatggcgagcttgttaagaacatgcat
atgattattcaagagcgttgtgttcttaacaaagagtttagatacgctaagaattttgaa
gattactatgcgttttgcaaagagattttgattccgcatatgcaagaagtgtttgagcgt
aaagaattttctttaatactcagctcagagcatgcgaatatgtttgggatttttcaagct
tttaggagcgttcataaggataaaaagatagggattttatatttagacgctcatgcggac
attcatacggcttatgatagcgattcagggcatattcatggcatgcctttaggaatggtc
ttaaatcgtgtacatagtgggtttaatagcatgaataagagcgaagaaaaagcgtggcaa
gagctttgtgctttgggcttagaaaaagggggcttagagattaatcctaagaatattgtg
tattttggagtaagaagcaccgagcagagcgaaagagatgtgattgaagaattgcaaatt
cctttgtttagcgtgaatgatataaaagagaacatgcaagaagtggtgcaaaaggctaaa
gagctgctaaaagaagtggatattatttatttgagtttagatgtggatattatggatggc
aagcttttcacatctactggcgtgcgtgaaaatggtgggttaagttttcaagaattaagg
caatttcttagcttgcttttagaaacttttaaggataagttaggggcgcttgaggttact
gaatacaatcccttagtgggtgctaaagatgaagaagaacaggttttagagatattgcga
ctcgtgattgatagttgcaagggctaa

DBGET integrated database retrieval system