KEGG   Helicobacter cetorum MIT 99-5656: HCD_04765Help
Entry
HCD_04765         CDS       T02033                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00220  Arginine biosynthesis
hcm00330  Arginine and proline metabolism
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01130  Biosynthesis of antibiotics
hcm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HCD_04765
   00330 Arginine and proline metabolism
    HCD_04765
Enzymes [BR:hcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HCD_04765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFI05957
UniProt: I0ESN8
Position
995880..996806
Genome map
AA seq 308 aa AA seqDB search
MILVGLEAELGASKKGTNEGVRRLREALSNTHGELVKNMHMIIQERCVLNKEFRYAKNFE
DYYAFCKEILIPHMQEVFERKEFSLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSGHIHGMPLGMVLNRVHSGFNSMNKSEEKAWQELCALGLEKGGLEINPKNIV
YFGVRSTEQSERDVIEELQIPLFSVNDIKENMQEVVQKAKELLKEVDIIYLSLDVDIMDG
KLFTSTGVRENGGLSFQELRQFLSLLLETFKDKLGALEVTEYNPLVGAKDEEEQVLEILR
LVIDSCKG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattttagttggattagaagccgagttaggggcgtcaaaaaaaggcacaaatgagggg
gttaggcgtttaagagaagctttaagcaacacgcatggcgagcttgttaagaacatgcat
atgattattcaagagcgttgtgttcttaacaaagagtttagatacgctaagaattttgaa
gattactatgcgttttgcaaagagattttgattccgcatatgcaagaagtgtttgagcgt
aaagaattttctttaatactcagctcagagcatgcgaatatgtttgggatttttcaagct
tttaggagcgttcataaggataaaaagatagggattttatatttagacgctcatgcggac
attcatacggcttatgatagcgattcagggcatattcatggcatgcctttaggaatggtc
ttaaatcgtgtacatagtgggtttaatagcatgaataagagcgaagaaaaagcgtggcaa
gagctttgtgctttgggcttagaaaaagggggcttagagattaatcctaagaatattgtg
tattttggagtaagaagcaccgagcagagcgaaagagatgtgattgaagaattgcaaatt
cctttgtttagcgtgaatgatataaaagagaacatgcaagaagtggtgcaaaaggctaaa
gagctgctaaaagaagtggatattatttatttgagtttagatgtggatattatggatggc
aagcttttcacatctactggcgtgcgtgaaaatggtgggttaagttttcaagaattaagg
caatttcttagcttgcttttagaaacttttaaggataagttaggggcgcttgaggttact
gaatacaatcccttagtgggtgctaaagatgaagaagaacaggttttagagatattgcga
ctcgtgattgatagttgcaagggctaa

DBGET integrated database retrieval system