KEGG   Helicobacter cetorum MIT 99-5656: HCD_04965Help
Entry
HCD_04965         CDS       T02033                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Brite
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HCD_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040361..1041422)
Genome map
AA seq 353 aa AA seqDB search
MKKSLLFGVTAFCVALSCVHAISDLGLIKKARENHLEPMPIGKALREYQIKKTKDVGIGT
KNAEIMTEAQIELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLAPKAVGTQWKSNPHFL
NSPTVYNSVFNDVQFWDGRVTRLGEQAQGPIQAPFEMGADPKVVVEKINSMPGYVKLFKK
AYGSKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNAKALSKAEQEGLEVFIEKGCVGC
HNGINLGGSMQAFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKD
AIKEMGSIQLGIQISDEEAKKIEVFFGALKGKKPKITYPELPAITDKTPKPVY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaatcacttttgtttggtgttacagcgttttgcgtggcactttcttgtgtgcat
gcaatcagtgatttgggattgattaagaaggctagagaaaatcatttagagcctatgcct
ataggtaaagcgcttagagaatatcaaatcaaaaaaactaaagatgtgggtattggcact
aaaaacgcagaaataatgacagaagctcaaattgaattgggcaaaatgctttattttgac
ccaagaatttctacttcttacttagtatcttgtaacacttgccacaatctagggcttggt
ggcgtggatttagcccctaaagctgtaggcactcaatggaagagtaatcctcacttttta
aactctccaaccgtgtataactcagtctttaatgatgtgcaattttgggatggcagagtt
acacgcttaggcgagcaagctcaaggacctattcaagccccttttgaaatgggtgctgac
cccaaagtggtagtagaaaaaattaattctatgcccggctatgtgaaactctttaaaaaa
gcttatggctccaaagtaaaaattgatttcaagcttattgctgatagcatcgccatgttt
gaagcgactttaataaccccaagccgctatgatgatttcttaagaggcaatgcaaaagcc
ttaagcaaagcagaacaagagggcttagaagtatttattgaaaagggttgtgtgggttgt
cataatggtattaatttaggtggttctatgcaagcctttggcgtggttaaaccttataaa
ttcgctaatgtgggcgatttcaaaggcgataaaaatgggcttgttaaagtgccgactcta
agaaatatcacagaaaccatgccctatttccataacggacaattttgggatgtcaaagat
gcgattaaggagatgggttccattcagttaggcattcaaattagtgatgaagaagctaaa
aaaattgaagttttctttggtgccttaaagggcaaaaaaccaaaaatcacctacccagag
cttcctgcaataacagataaaaccccaaaacctgtttattag

DBGET integrated database retrieval system