KEGG   Helicobacter cetorum MIT 99-5656: HCD_06425Help
Entry
HCD_06425         CDS       T02033                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00240  Pyrimidine metabolism
hcm00250  Alanine, aspartate and glutamate metabolism
hcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HCD_06425 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HCD_06425 (pyrB)
Enzymes [BR:hcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HCD_06425 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFI06287
UniProt: I0ETL8
Position
complement(1362677..1363600)
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLSVDEIKLLLEKASEYGDDFNAVSSETKERMQDKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQASSTSKGETLIDTFKNIHAMQPNAIIMRHAFSSAPFKLV
EFSQCPLINAGSGVSAHPTQALLDLLTIYKHFGSKLENLKGKKIAIIGDVKNSRVANSNI
KLLSRFGLEMMLCAPSSMLPVTSLRTTHKIEEAIEFADILMSLRTQTERHDTPIFASLKD
YSNAYCITKERLEAYAKNKEVIILHPGPVHRDIDVESAVLEDERSKVLEQVKNGVAMRMA
VLEFLLA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgtcatttacttcaaacaagtgatttaagcgttgatgaaattaaa
cttttgctggaaaaagcaagcgaatatggcgatgattttaacgctgtgtcttcagaaaca
aaagagagaatgcaagataaaattatcgtggctttgttttttgaaaattccactagaacg
gtgtctagctttgagattgcaagcttaagattaggggcaaaaatcgtgaaattaaacatg
caagcaagctctacttcaaagggtgagactttaatagacacttttaaaaatatccatgcg
atgcaacctaacgctattattatgcgccatgccttttcaagtgcaccttttaaattagtg
gagttttctcaatgccctttaatcaatgctggaagtggcgtgagtgctcatcctactcaa
gctctactagacttactgacaatttataagcattttggtagtaaattagaaaatttgaaa
ggaaagaaaatcgcaattatcggcgatgtaaaaaattcaagagtagcaaatagtaacatt
aagttgctttcacgatttggacttgagatgatgctatgtgccccaagctccatgcttcct
gtaacttctttaagaacgacacataaaattgaagaagctatagagtttgcagatattttg
atgagcttaagaacccaaactgaacgccatgatacgcctatttttgcgagcttaaaggat
tatagcaacgcctattgtatcactaaagagcgtttagaggcttatgctaagaataaagaa
gtgataatcttacacccaggcccagtgcatagggatattgatgtagaaagtgctgtgtta
gaagatgaacgctctaaggttttagagcaagtcaaaaatggcgtggcaatgcgtatggcg
gtattggaatttttgcttgcataa

DBGET integrated database retrieval system