KEGG   Helicobacter cetorum MIT 99-5656: HCD_06765Help
Entry
HCD_06765         CDS       T02033                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCD_06765
   00052 Galactose metabolism
    HCD_06765
   00500 Starch and sucrose metabolism
    HCD_06765
   00520 Amino sugar and nucleotide sugar metabolism
    HCD_06765
Enzymes [BR:hcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCD_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1440365..1441186)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMQAGCEVMAIVTGRNKR
SLENYFDTSYEIEHQIQGTSKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCTSNEHPSVLKQMTTLYQKYQCPIVAIEEVALEEVSKYGVIKGELLED
GVYEIKDMVEKPSQEAAPSNLAVIGRYILTPDIFDILRMTKPGKNNEIQITDALLTQAKQ
KRIIAYQFKGKRYDCGSVEGYIEATNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgccgctggctatggcacacgctttttaccgattact
aaaaccattcctaaagagatgttgcctattgtagataaacctttaatgcaatatgctgtg
gaagaagctatgcaagcaggctgtgaagtcatggcgattgttacaggcagaaacaagcga
agcctagaaaattattttgatacgagttatgaaatagagcatcaaattcaaggcacaagc
aaagagaacgccttaaaaagcatccgcaatatcatagaaaaatgctgtttttcctatgtg
cgacaaaaacaaatgaagggtctagggcatgcgatattaaccggagaagcccttataggc
aatgagccttttgcggtgattttggctgatgatttatgcacaagcaacgaacatccaagt
gtcttaaagcaaatgacgaccttgtatcaaaaatatcaatgccccattgttgccattgaa
gaagtggcgttagaagaagtctcaaaatacggcgtgattaagggcgaattattagaagat
ggggtgtatgagattaaagatatggttgaaaaacctagtcaagaagccgccccaagcaat
ttggctgtgatagggcgttacattctaacccctgatatttttgatattttgcgtatgact
aaacccggtaaaaataatgaaatccaaattacagacgcccttttaactcaagctaaacaa
aaacgcattatcgcctatcaattcaaaggcaaacgctatgattgtggaagcgtagaaggc
tatattgaagcgactaatgcgtattataaaaaacgcttataa

DBGET integrated database retrieval system