KEGG   Helicobacter cetorum MIT 99-5656: HCD_06765Help
Entry
HCD_06765         CDS       T02033                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00040  Pentose and glucuronate interconversions
hcm00052  Galactose metabolism
hcm00500  Starch and sucrose metabolism
hcm00520  Amino sugar and nucleotide sugar metabolism
hcm01100  Metabolic pathways
hcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCD_06765
   00052 Galactose metabolism
    HCD_06765
   00500 Starch and sucrose metabolism
    HCD_06765
   00520 Amino sugar and nucleotide sugar metabolism
    HCD_06765
Enzymes [BR:hcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCD_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFI06352
UniProt: I0ETT3
Position
complement(1440365..1441186)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMQAGCEVMAIVTGRNKR
SLENYFDTSYEIEHQIQGTSKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCTSNEHPSVLKQMTTLYQKYQCPIVAIEEVALEEVSKYGVIKGELLED
GVYEIKDMVEKPSQEAAPSNLAVIGRYILTPDIFDILRMTKPGKNNEIQITDALLTQAKQ
KRIIAYQFKGKRYDCGSVEGYIEATNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgccgctggctatggcacacgctttttaccgattact
aaaaccattcctaaagagatgttgcctattgtagataaacctttaatgcaatatgctgtg
gaagaagctatgcaagcaggctgtgaagtcatggcgattgttacaggcagaaacaagcga
agcctagaaaattattttgatacgagttatgaaatagagcatcaaattcaaggcacaagc
aaagagaacgccttaaaaagcatccgcaatatcatagaaaaatgctgtttttcctatgtg
cgacaaaaacaaatgaagggtctagggcatgcgatattaaccggagaagcccttataggc
aatgagccttttgcggtgattttggctgatgatttatgcacaagcaacgaacatccaagt
gtcttaaagcaaatgacgaccttgtatcaaaaatatcaatgccccattgttgccattgaa
gaagtggcgttagaagaagtctcaaaatacggcgtgattaagggcgaattattagaagat
ggggtgtatgagattaaagatatggttgaaaaacctagtcaagaagccgccccaagcaat
ttggctgtgatagggcgttacattctaacccctgatatttttgatattttgcgtatgact
aaacccggtaaaaataatgaaatccaaattacagacgcccttttaactcaagctaaacaa
aaacgcattatcgcctatcaattcaaaggcaaacgctatgattgtggaagcgtagaaggc
tatattgaagcgactaatgcgtattataaaaaacgcttataa

DBGET integrated database retrieval system