KEGG   Helicobacter cetorum MIT 99-5656: HCD_07110Help
Entry
HCD_07110         CDS       T02033                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Brite
Enzymes [BR:hcm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HCD_07110
Secretion system [BR:hcm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HCD_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1509976..1510770)
Genome map
AA seq 264 aa AA seqDB search
MILRASVLSALLLVGLGAAPKNPAYKSMQDNLVKVIEKQTSKKVSVLEIKPLKSSQDLKI
VVVEDPDTKYHIPLVVSKDGNLIIGLSNIFFSNKSEDVQLVTEINQEIQTLNTTQQNSSK
LNALFEAIPSDYVIELPSSNAKNRDKILYIVSDPMCPHCQKELTKIKEHLKESSVRMVIV
GWLGVNSAKKAAIIQEEIAQARAKGASVEDKIAIIEKIYSTQYDINAQKEPEGLRTKVEN
TTKKIFESGVIKYVPFLYKYKAAK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtattgagcgcgttacttcttgtaggtttaggagctgctcct
aaaaatccagcctataagtcaatgcaagataatttggtgaaagtgattgaaaagcaaacg
agcaagaaagtgagcgttttagaaattaagcctttgaaatccagccaagatttaaaaatt
gttgtggtagaagacccagacactaagtatcacattccgcttgtagtgagtaaggatggt
aatttaatcatagggcttagcaatatcttttttagcaataagagcgaagatgtgcaattg
gttacagaaatcaatcaagaaatccaaacccttaacaccactcagcaaaatagctctaag
ctaaacgccttgtttgaagcgattcctagcgattatgttatagaattgccttctagcaac
gctaaaaatagggataaaatcctttatatcgtttcagaccctatgtgtccgcattgtcaa
aaagagcttactaagattaaagagcatttgaaagaaagtagcgtgagaatggttattgta
gggtggcttggagttaattcagctaaaaaggcggctatcattcaagaagaaatcgcccaa
gctagagctaagggagcgagcgtagaagataaaattgctatcattgaaaagatttattcc
acacaatatgatattaacgctcaaaaagaaccagaagggttacgcaccaaagtagaaaac
accactaaaaagatttttgaaagcggtgtgattaaatatgtgcctttcttatacaagtat
aaggccgctaaatga

DBGET integrated database retrieval system