KEGG   Helicobacter cetorum MIT 99-5656: HCD_07735Help
Entry
HCD_07735         CDS       T02033                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCD_07735
Enzymes [BR:hcm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HCD_07735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1636803..1637945
Genome map
AA seq 380 aa AA seqDB search
MTLARLNPNALKTALQNIDSEKIAQAHMYKKGVSLVFEIKDLPLSATLILKQEALSVGGD
FATPKDCILAKKPFYDGVLIVNAKQLERLITKCYSQPFGLKALAQELKNHLKAPKPNAPQ
IMAILNLTPDSFYEKSRFNSKNAIEEIYQLLEKGITLIDIGAASSKPGSEIIDPKIEQKR
LKEVLCEIKSQKLNEHAKFSIDTYHASTAKMALEHHFSVLNDVSGFNSVEMLEVARDYKP
TCVLMHAKKTPKDMQENVFYHNLFDEMDIFFKDKLETLEKYALKDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVEKRLSGTLALHLMALQNGASILRV
HDVDEHIDLIKVFHSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactttagcacgccttaatcctaacgccttaaaaaccgcccttcaaaacatagattca
gaaaaaatcgctcaagcccatatgtataaaaaaggcgttagtttagtctttgaaatcaaa
gatttgcccctaagcgctacacttattttaaaacaagaagccttgagtgtggggggtgat
ttcgccacaccaaaagattgtatcttggctaaaaagcctttttatgatggtgtgttaatc
gttaatgccaaacaactagaacgccttatcaccaagtgctattcccaaccctttgggctt
aaagctctagcacaggaattaaaaaatcatctcaaagcccccaagcctaacgccccacaa
attatggcaattttaaatctcacgcctgatagcttctatgaaaagagtcgttttaatagc
aaaaatgccattgaagaaatctatcaactccttgaaaaaggcatcactctcattgatata
ggtgcagcaagctcaaaaccaggaagtgaaatcattgacccaaagatagaacaaaagcgt
ttgaaagaagttttatgcgaaatcaaatctcaaaaactcaatgaacatgctaaatttagt
atagacacctatcatgcaagcacagccaaaatggctttagaacaccatttttctgttctt
aatgatgtgagcggttttaatagcgttgaaatgctagaagtcgcaagagactacaagcct
acttgtgttttaatgcatgccaaaaaaactcccaaagacatgcaagaaaatgtcttttat
cacaacttatttgatgaaatggatattttctttaaagacaaactagagactttagaaaaa
tacgcccttaaggatattattttagatatagggtttggatttgccaaactaaaagagcat
aatctagccttaatcaagcacttaagccactttctaaaatttaaaaagcccttattagtg
ggggcaagccgtaaaaacactatcggtcttattacagggcgtgaagttgaaaagcgactt
tctggcactttagctttgcatttaatggcattacaaaatggagcgagcattttaagagtg
catgatgttgatgagcatatagatttaatcaaagtgtttcatagcttagaagaaactgat
taa

DBGET integrated database retrieval system