KEGG   Helicobacter cetorum MIT 99-5656: HCD_08000Help
Entry
HCD_08000         CDS       T02033                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00010  Glycolysis / Gluconeogenesis
hcm00020  Citrate cycle (TCA cycle)
hcm00620  Pyruvate metabolism
hcm00640  Propanoate metabolism
hcm00650  Butanoate metabolism
hcm00680  Methane metabolism
hcm01100  Metabolic pathways
hcm01120  Microbial metabolism in diverse environments
hcm01130  Biosynthesis of antibiotics
hcm01200  Carbon metabolism
Module
hcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08000
   00020 Citrate cycle (TCA cycle)
    HCD_08000
   00620 Pyruvate metabolism
    HCD_08000
   00640 Propanoate metabolism
    HCD_08000
   00650 Butanoate metabolism
    HCD_08000
  Energy metabolism
   00680 Methane metabolism
    HCD_08000
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCD_08000
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCD_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFI06584
UniProt: I0EUG5
Position
1696639..1697199
Genome map
AA seq 186 aa AA seqDB search
MLQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIEDIFADEKEDTTYIITSYLSKEELFEKKPELKTRKVFMLD
CLKISMETLKRPIPNTPMLGALMKVSNMLEIEAFKEAFQKVLGKKLAKEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaattagatggcatgcacgagctggtcaaggtgcaatcacaggtgctaaagga
ctagctgatgtaatttcaaaaacaggcaaggaagtgcaagcattcgcttcttatggttca
gctaaaaggggagcagcgatgatggcgtataatcgcattgatgatgagcctatcttaaat
catgaacgcttcatgcaacctgattatgttttggtgatcgacccgggattagtgtttatt
gaagatatttttgctgatgaaaaagaagacaccacttacattattacgagttatttgagc
aaagaagaattatttgaaaaaaaacctgaattaaaaacccgcaaggtgtttatgctagat
tgtttaaaaatttctatggagactttgaagcgtcctattcctaacacgcctatgctaggg
gcgttgatgaaagtgtctaacatgcttgaaattgaagcgtttaaggaagcgtttcaaaag
gttttgggtaagaaattggctaaagaagtcattgatgcgaatatgctcgccattcaaaga
gcctatgaagaagttcaataa

DBGET integrated database retrieval system