KEGG   Helicobacter cetorum MIT 99-5656: HCD_08005Help
Entry
HCD_08005         CDS       T02033                                 

Gene name
porD
Definition
pyruvate flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCD_08005 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08005 (porD)
   00020 Citrate cycle (TCA cycle)
    HCD_08005 (porD)
   00620 Pyruvate metabolism
    HCD_08005 (porD)
   00640 Propanoate metabolism
    HCD_08005 (porD)
   00650 Butanoate metabolism
    HCD_08005 (porD)
  Energy metabolism
   00680 Methane metabolism
    HCD_08005 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCD_08005 (porD)
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCD_08005 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697209..1697601
Genome map
AA seq 130 aa AA seqDB search
MKNWNEFEMGAVLFPFESNAQSEVEKHNDERNYTKESYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVSVCPTNPKSLWMFEEQVEPAMALTQ
WPAKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggaatgaatttgaaatgggagcggtgcttttcccttttgaaagtaatgca
caaagcgaagtagaaaaacataatgatgaacgcaactacactaaagagagctatttcacc
acttcagtagctcattggcgtgtagcaaaaccggtgcataacaacaacatctgtattaat
tgtttcaattgctgggtttattgtcctgatgcagccattctttcaagagaaggcaagcta
aagggtgtggattattctcattgtaagggctgtggagtgtgtgtgagtgtttgtcctact
aatcccaaatcgctatggatgtttgaagagcaagttgagcctgctatggcactcactcaa
tggccagcaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system