KEGG   Helicobacter cetorum MIT 99-5656: HCD_08005Help
Entry
HCD_08005         CDS       T02033                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00010  Glycolysis / Gluconeogenesis
hcm00020  Citrate cycle (TCA cycle)
hcm00620  Pyruvate metabolism
hcm00640  Propanoate metabolism
hcm00650  Butanoate metabolism
hcm00680  Methane metabolism
hcm01100  Metabolic pathways
hcm01120  Microbial metabolism in diverse environments
hcm01130  Biosynthesis of antibiotics
hcm01200  Carbon metabolism
Module
hcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08005 (porD)
   00020 Citrate cycle (TCA cycle)
    HCD_08005 (porD)
   00620 Pyruvate metabolism
    HCD_08005 (porD)
   00640 Propanoate metabolism
    HCD_08005 (porD)
   00650 Butanoate metabolism
    HCD_08005 (porD)
  Energy metabolism
   00680 Methane metabolism
    HCD_08005 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCD_08005 (porD)
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCD_08005 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AFI06585
UniProt: I0EUG6
Position
1697209..1697601
Genome map
AA seq 130 aa AA seqDB search
MKNWNEFEMGAVLFPFESNAQSEVEKHNDERNYTKESYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVSVCPTNPKSLWMFEEQVEPAMALTQ
WPAKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattggaatgaatttgaaatgggagcggtgcttttcccttttgaaagtaatgca
caaagcgaagtagaaaaacataatgatgaacgcaactacactaaagagagctatttcacc
acttcagtagctcattggcgtgtagcaaaaccggtgcataacaacaacatctgtattaat
tgtttcaattgctgggtttattgtcctgatgcagccattctttcaagagaaggcaagcta
aagggtgtggattattctcattgtaagggctgtggagtgtgtgtgagtgtttgtcctact
aatcccaaatcgctatggatgtttgaagagcaagttgagcctgctatggcactcactcaa
tggccagcaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system