KEGG   Helicobacter cetorum MIT 99-5656: HCD_08015Help
Entry
HCD_08015         CDS       T02033                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00010  Glycolysis / Gluconeogenesis
hcm00020  Citrate cycle (TCA cycle)
hcm00620  Pyruvate metabolism
hcm00640  Propanoate metabolism
hcm00650  Butanoate metabolism
hcm00680  Methane metabolism
hcm01100  Metabolic pathways
hcm01120  Microbial metabolism in diverse environments
hcm01130  Biosynthesis of antibiotics
hcm01200  Carbon metabolism
Module
hcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08015
   00020 Citrate cycle (TCA cycle)
    HCD_08015
   00620 Pyruvate metabolism
    HCD_08015
   00640 Propanoate metabolism
    HCD_08015
   00650 Butanoate metabolism
    HCD_08015
  Energy metabolism
   00680 Methane metabolism
    HCD_08015
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCD_08015
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCD_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: AFI06587
UniProt: I0EUG8
Position
1698848..1699792
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCTAV
YPHTSWDVPWIHIGFENGSTAISGVETMYKALANKGRYKGQRPKFVAFGGDGSSYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSSSTPLGASTSTTPAGSVSFGKKEKKKDIVT
IMASHGIPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNQTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIISVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAGV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtaaaaacacttaagggttttagccaaagcgctgagaagtttcagggt
tcacacctactttgtccgggttgtgggcatggtattattgtgcgtgaagttctaaatgcc
gtggatgggcctattgttttaggtaactctacaggttgtttggaagtatgcaccgctgta
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaacggctctaca
gccatttcaggtgtagaaaccatgtataaggctctagctaataaagggcgttataagggt
caaagaccaaaatttgtcgcctttggaggcgatggctctagttatgatattggttttcaa
tttattagtggctgtatggaaagagggcatgatatgacctatatttgcttggataatgaa
aactacgcaaataccggtggtcaaagaagttcttccacaccattaggggctagcacttct
actacgccagcgggttcggtgagctttggtaaaaaagaaaagaaaaaagacatcgtaacc
attatggcaagccatgggattccttatgtggcacaactttctcctaataagtggaaagat
atgaataaaaagattaagaccgcactagacactgaagggccttgctttatcaacgctctt
agtccatgcaccactgagtggaagtttgaatctaatcaaaccattgaattagcggatatg
gcagtagatagcttgatgtttcctttatttgaaatctttaatggcagagagttgaaaatt
acttaccgcccaagaaacatcatctctgtgagagactatttgggtgctcaaaagcgtttc
aaacaccttttcaaaaaagaaaacgagcacatcattgaagaattacaaaaagatgtgaat
gagcgttgggagtatttacaacgcagagaagaagctggagtataa

DBGET integrated database retrieval system