KEGG   Helicobacter cetorum MIT 99-5656: HCD_08050Help
Entry
HCD_08050         CDS       T02033                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCD_08050
Enzymes [BR:hcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HCD_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1708231..1709322
Genome map
AA seq 363 aa AA seqDB search
MVVLGSTGSIGKNALKIATKFNIEIEALSCGRNIALLNEQIKIFKPKKVAILDSKDLSHL
EPLNAKVFVGLGGIDEMIEECSSSLVINAIVGVAGLKASFKSLQTHKRLALANKESLVSA
GHLLDVSKITPIDSEHFGLWALLQNKVLKPKSLIITASGGAFRDTPLELIPTQSVENALK
HPNWSMGAKITIDSASMVNKLFEILETYWLFGASLKIDAVIERSSIVHALVECEDNSVIS
HLASTDMKLPISYAINPKLAYLNASIKPLDLCTLSAIKFEPIHTERYALWRYKDLLLENP
KLGVVLNASNEKAIERFLNKEIAFGSLIKIISQALEMYAKKSLKLSSLEEVLELDKEVRG
RLS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggttgttctaggaagcactggctctatcggaaaaaacgccctaaaaatcgcaacaaaa
ttcaacatagaaatagaagcactaagttgtgggagaaatatcgctcttttaaatgaacaa
atcaagatttttaagcctaagaaagtcgccatcttagattctaaagatttaagccactta
gaacctttgaatgccaaagtgtttgtagggctaggtggcattgatgagatgatagaagag
tgctcttctagcttggtaataaatgctattgtaggtgtggcaggattaaaagcgagtttt
aaaagcttgcagactcataaaagactagccctagcgaataaagaaagcttagtgagtgca
gggcatttactagatgttagtaaaatcacgcccattgatagcgagcattttggcttgtgg
gcgttgttgcaaaacaaagttttaaagcccaaatccttaatcattaccgctagtgggggg
gcttttagagacactccattagaactcattcctactcaaagcgtagagaacgctcttaag
caccctaattggagcatgggggcaaaaatcacgattgattcagcaagcatggtcaataag
ctttttgaaatcttagaaacctattggctttttggggcttctttaaaaattgatgctgta
attgagagaagttctatcgtgcatgccttggtggaatgtgaagataattctgtgatttcg
catttagcaagcacggatatgaaactgcctattagctatgcaatcaacccaaaactagcc
tatttgaacgcctctattaagcccttagatttatgcactttaagtgctattaaatttgag
cctatccatacagagcgttacgctttatggcgttataaggatttgttgctagaaaaccca
aagcttggtgtggtgcttaatgcgagcaatgaaaaagcgatagaaaggtttttgaataaa
gaaattgcatttggaagtcttattaaaatcatctctcaagccctagaaatgtatgctaaa
aagtctctcaaactctctagcttagaagaagtgctagagttagataaagaagtgagaggg
cgtttaagttag

DBGET integrated database retrieval system