KEGG   Helicobacter cetorum MIT 99-5656: HCD_08460Help
Entry
HCD_08460         CDS       T02033                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00010  Glycolysis / Gluconeogenesis
hcm00052  Galactose metabolism
hcm00500  Starch and sucrose metabolism
hcm00520  Amino sugar and nucleotide sugar metabolism
hcm00521  Streptomycin biosynthesis
hcm01100  Metabolic pathways
hcm01110  Biosynthesis of secondary metabolites
hcm01120  Microbial metabolism in diverse environments
hcm01130  Biosynthesis of antibiotics
hcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08460 (glk)
   00052 Galactose metabolism
    HCD_08460 (glk)
   00500 Starch and sucrose metabolism
    HCD_08460 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HCD_08460 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCD_08460 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HCD_08460 (glk)
Enzymes [BR:hcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HCD_08460 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFI06674
UniProt: I0EUQ5
Position
1796346..1797344
Genome map
AA seq 332 aa AA seqDB search
MPKTKTYPRLLADIGGTNARFGLEIAPRQIEYIEVLQCKDFESLSDAVRFYLSKYKENLK
LHPLYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLGLEKLLVINDFEAQAYAISAMQE
SDLAQVGGIKCEINAPKAILGPGTGLGVSTLIHNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGFQKAAKLSKAELTPQIISERALNGD
YPLCRLTLDTFCAMLGTLASDVALTLGARGGVYLCGGIIPRFIDYFKTSPFRVRFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagactaaaacttacccaagactattagccgatatcggtggcacaaacgcacgc
tttggcttagaaatcgccccacgacaaattgaatacattgaagtcttacaatgtaaagat
tttgagagcttaagcgatgcggtgcgtttctatctctctaaatataaagaaaatcttaaa
ttgcaccccctttatggctcttttgctgtggctacgcccattatgggcgattttgtccaa
atgactaacaaccactggactttttctatagaaaccacaaggcaatgtttgggtttagaa
aaattgcttgtgattaatgattttgaggcacaagcctatgccattagtgcgatgcaagaa
agcgatttagctcaagtgggtggaatcaaatgtgaaatcaacgcccctaaggcaattttg
gggccaggaactgggctaggggtaagcactcttattcataatagtgatggctctttaaaa
gtattgcccggcgaaggggggcatgtgagctttgccccttttgatgatttggaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttgagtggg
agtggcttggtgctgatttatgaagccctatccaaacgcaaaggttttcaaaaagcagcc
aagttaagcaaggctgagctgaccccacaaattattagcgaacgggctttgaatggggat
tatcctttatgcagattgacactagatactttttgtgcgatgctaggcacactagcctct
gatgtggctcttaccttaggtgctagggggggcgtgtatttgtgcggcgggataattcca
cgatttattgattattttaaaacttcgccttttagagtgcgttttgagactaaagggcgt
atgggagcgtttctagcttctattcctgtgcatgtcgtgttgaaaaaaactcctggactt
gatggagcaggcattgcgttagagaattatttggtgtag

DBGET integrated database retrieval system