KEGG   Helicobacter cetorum MIT 99-5656: HCD_08460Help
Entry
HCD_08460         CDS       T02033                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCD_08460 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCD_08460 (glk)
   00052 Galactose metabolism
    HCD_08460 (glk)
   00500 Starch and sucrose metabolism
    HCD_08460 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HCD_08460 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCD_08460 (glk)
   00524 Butirosin and neomycin biosynthesis
    HCD_08460 (glk)
Enzymes [BR:hcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HCD_08460 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796346..1797344
Genome map
AA seq 332 aa AA seqDB search
MPKTKTYPRLLADIGGTNARFGLEIAPRQIEYIEVLQCKDFESLSDAVRFYLSKYKENLK
LHPLYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLGLEKLLVINDFEAQAYAISAMQE
SDLAQVGGIKCEINAPKAILGPGTGLGVSTLIHNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGFQKAAKLSKAELTPQIISERALNGD
YPLCRLTLDTFCAMLGTLASDVALTLGARGGVYLCGGIIPRFIDYFKTSPFRVRFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagactaaaacttacccaagactattagccgatatcggtggcacaaacgcacgc
tttggcttagaaatcgccccacgacaaattgaatacattgaagtcttacaatgtaaagat
tttgagagcttaagcgatgcggtgcgtttctatctctctaaatataaagaaaatcttaaa
ttgcaccccctttatggctcttttgctgtggctacgcccattatgggcgattttgtccaa
atgactaacaaccactggactttttctatagaaaccacaaggcaatgtttgggtttagaa
aaattgcttgtgattaatgattttgaggcacaagcctatgccattagtgcgatgcaagaa
agcgatttagctcaagtgggtggaatcaaatgtgaaatcaacgcccctaaggcaattttg
gggccaggaactgggctaggggtaagcactcttattcataatagtgatggctctttaaaa
gtattgcccggcgaaggggggcatgtgagctttgccccttttgatgatttggaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttgagtggg
agtggcttggtgctgatttatgaagccctatccaaacgcaaaggttttcaaaaagcagcc
aagttaagcaaggctgagctgaccccacaaattattagcgaacgggctttgaatggggat
tatcctttatgcagattgacactagatactttttgtgcgatgctaggcacactagcctct
gatgtggctcttaccttaggtgctagggggggcgtgtatttgtgcggcgggataattcca
cgatttattgattattttaaaacttcgccttttagagtgcgttttgagactaaagggcgt
atgggagcgtttctagcttctattcctgtgcatgtcgtgttgaaaaaaactcctggactt
gatggagcaggcattgcgttagagaattatttggtgtag

DBGET integrated database retrieval system