KEGG   Helicobacter pylori HUP-B14: HPB14_00940Help
Entry
HPB14_00940       CDS       T02035                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00010  Glycolysis / Gluconeogenesis
hcn00051  Fructose and mannose metabolism
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
hcn01200  Carbon metabolism
hcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB14_00940 (tpiA)
   00051 Fructose and mannose metabolism
    HPB14_00940 (tpiA)
   00562 Inositol phosphate metabolism
    HPB14_00940 (tpiA)
Enzymes [BR:hcn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPB14_00940 (tpiA)
Exosome [BR:hcn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPB14_00940 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPB14_00940 (tpiA)
  Exosomal proteins of melanoma cells
   HPB14_00940 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFI06903
UniProt: I0EVD4
Structure
PDB: 

Jmol
Position
190194..190898
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGVQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGLVAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgacagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagtgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcaaagcatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagaggagagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggtttagtggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagtgcttctttagaagacatttacctcacgcatggt
tttttaaaacaaatcttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system