KEGG   Helicobacter pylori HUP-B14: HPB14_01050Help
Entry
HPB14_01050       CDS       T02035                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPB14_01050
Enzymes [BR:hcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPB14_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214488..215582
Genome map
AA seq 364 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVEIEALSCGKNIALINEQIKVFKPEKVAILDPSDLNDL
EPLGAEVFVGLEGIDAMIEECVSNLVINAIVGVAGLKASFKSLQTNKKLALANKESLVSA
GHLLDISKITPVDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLEFIPIQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSVIA
HLASADMKLPISYAIDPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAMEKFLNQEIAFGGLIQTISQALESYAKMSFKLSSLDEVLELDKEVRE
RFKM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcactggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtagaaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccgagaaagtggcgattttagatcctagcgatttgaatgattta
gagcctttgggcgcggaagtgtttgtagggctagagggcattgatgcgatgatagaagag
tgcgtttccaatttagtcattaacgccattgtgggcgtagccggattgaaagcgagcttt
aaaagcttacaaactaacaaaaaactagccctagcgaataaagaaagtttagtgagcgcg
gggcatttattagacatttctaaaatcacgcccgttgatagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagtgcgagtgggggg
gctttcagggacacgcctttagaatttattcctattcaaaacgcgcaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaattttagaaacctactggctttttggcgcgtctttaaagattgatgcgctc
attgaaaggagttctatcgtgcatgctttggtggagtttgaagataactctgtcatcgcg
catttagcgagcgcggacatgaaactacccataagctatgcgatcgatccgaagttggcc
tctttgagcgcgtctatcaagcccttagatctatacgctttaagcgcgattaaattcgaa
cccattagcatggagcgctacaccttgtggcgttataaagacttgttattagaaaacccc
aagcttggcgtggtgctgaacgcgagcaatgaagtggcgatggagaagtttttaaatcaa
gaaatcgcttttggtggccttatccaaaccatttctcaagccttagaatcatacgctaaa
atgtctttcaagctctctagtttagatgaagtgctagaattagataaggaagttagggag
cgttttaaaatgtag

DBGET integrated database retrieval system