KEGG   Helicobacter pylori HUP-B14: HPB14_01140Help
Entry
HPB14_01140       CDS       T02035                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hcn  Helicobacter pylori HUP-B14
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231004..231801
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSDDVKLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttgaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaacatattctttagcaataaaagcgatgat
gtgaaattagttgcagaaaccaatcaaaaaatccaagctcttaacgccacccaacaaaat
agtgcgaaattgaacgctatttttaatgaaataccggctgattatgtgatagagttgccc
tctactaacgctgaaaataaggacaagatcctttatattgtctctgatcccatgtgtccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttaatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaa
gtggaaaacaccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttcttg
tatcattataaggcatga

DBGET integrated database retrieval system