KEGG   Helicobacter pylori HUP-B14: HPB14_01365Help
Entry
HPB14_01365       CDS       T02035                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPB14_01365
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPB14_01365
Enzymes [BR:hcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPB14_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274414..274989
Genome map
AA seq 191 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGVPSVFDLEVLGLLRRHANSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFSWRLGLGVFVETHKQDYTHLKDLGVLGVLENSPYSYNQKK
NSLFRLNFKLI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaaccaaagattgtgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggtgtg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgaactctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcccttgttcaaggctct
gatggggtcattttagatgaagagcttttgaaagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttaggcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaatagcccctattcttataatcaaaaaaaa
aatagtctttttagattgaattttaagctaatttag

DBGET integrated database retrieval system