KEGG   Helicobacter pylori HUP-B14: HPB14_03430Help
Entry
HPB14_03430       CDS       T02035                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00520  Amino sugar and nucleotide sugar metabolism
hcn00550  Peptidoglycan biosynthesis
hcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HPB14_03430
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPB14_03430
Enzymes [BR:hcn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HPB14_03430
Peptidoglycan biosynthesis and degradation proteins [BR:hcn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   HPB14_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase DUF2730 7TM_GPCR_Srh
Motif
Other DBs
NCBI-ProteinID: AFI07385
UniProt: I0EWR6
Position
complement(702785..704053)
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAAALLSRQEVKIKSLPQVVDIKAMALLLQNL
GASLEWLDPNTLQISAKSLSHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGVESDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLDIQENSIEIHPVKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNVATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVLRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaactccgcgctccccattttagccgccgcacttttaagccgccaagaagtcaaa
atcaaatccttgccccaagtggtggatataaaagcgatggcgttattattgcaaaattta
ggcgcgagcttagaatggcttgatcctaacacgcttcaaatcagtgctaaatccctgagc
cacaccgaagccacttacgatttggtgcgtaaaatgcgtgcttctattttggttttaggc
cctttattagcgcgttttaaagaatgcttagtgagtttgcccggtgggtgcgctatagga
gctaggcctgtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagcttagctaaaggg
atcacgcgcatcattaacgccgctaaagagccagaaatcactcaattgtgcgcgttttta
caaagtgggggggtagaaattgagggtgttggcagcagcgagttaaagattaggggggta
gaaagcgacgctttaaatttaaaagacattcaaatcataccagacaggattgaagcaggc
acttatttgtgcgtgggggctatcactaacagccagcttaaaatcaatcgtatcatccct
aaccatcttcaagcgatcaccgacaagctcatagaaattggtttttcgctagacattcaa
gaaaattctatagaaattcatccggtcaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccaggctttcccacagacatgcaagcgcaattcatggcactagccacgcagtgt
ttggggacgagcgtgattgaagagacgctttttgaaaaccgcttcatgcatgcgagcgag
ttgcaacgcttgggggctaatatcagcctaaaaacaaatgtggctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgacggatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattagaggataaaatcaacgctttaggggcaaaagtgttgcgtttaaaa
gaaaaataa

DBGET integrated database retrieval system