KEGG   Helicobacter pylori HUP-B14: HPB14_03440Help
Entry
HPB14_03440       CDS       T02035                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPB14_03440
   00052 Galactose metabolism
    HPB14_03440
   00500 Starch and sucrose metabolism
    HPB14_03440
   00520 Amino sugar and nucleotide sugar metabolism
    HPB14_03440
Enzymes [BR:hcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPB14_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(704475..705296)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacacgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataaacctttaatccaatacgctgtg
gaagaagcgatggaggcaggctgtgaagtgatggcgatcgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgctctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcctagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcagtgattttagccgacgacttatgcataagccatgatcatcctagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaacccaatcaagaagacgccccaagcaac
ctagccgtgatagggcgctacattttaaccccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacgcatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system