KEGG   Helicobacter pylori HUP-B14: HPB14_04215Help
Entry
HPB14_04215       CDS       T02035                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00564  Glycerophospholipid metabolism
hcn00565  Ether lipid metabolism
hcn00592  alpha-Linolenic acid metabolism
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPB14_04215
   00565 Ether lipid metabolism
    HPB14_04215
   00590 Arachidonic acid metabolism
    HPB14_04215
   00591 Linoleic acid metabolism
    HPB14_04215
   00592 alpha-Linolenic acid metabolism
    HPB14_04215
Enzymes [BR:hcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPB14_04215
    3.1.1.32  phospholipase A1
     HPB14_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFI07536
UniProt: I0EX67
Position
complement(872439..873506)
Genome map
AA seq 355 aa AA seqDB search
MKSILIFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTDWFQIYNNPQSAPMRMINFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGGPVIVKDYNGQKDVRWGGCRSVNAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgatctttatgatttttgtagtttgtcagttagagggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgtaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaatgcctggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttttgcctttttatcatagtttcacccccatttttcaatggtatcatcctaatatc
aacccgtatcaacgcaatgagtttaagttccaaatcagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctttatttggcttatacccaaactgactggtttcaa
atttataataaccctcaatccgctcccatgcgaatgatcaatttcatgcctgaactcatc
tatgtttatcctattaattttaaaccttttgggggtaaaatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggcgtgggaggcgcgcaatgttaccagcctttt
aataaagaaggtaatcctgaaaaccaattcccaggagggcctgtaatcgttaaagattat
aacgggcaaaaagacgtgcgctggggggggtgtcgttcggtgaatgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcttgaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattacatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaat
ccttttgtggggatttatgcacagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttgaacccttaa

DBGET integrated database retrieval system