KEGG   Helicobacter pylori HUP-B14: HPB14_04500Help
Entry
HPB14_04500       CDS       T02035                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hcn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943287..943868
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CSSCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaaccactttttaaatttagtggattgtttagaaaag
atccccaatgtgggtaaaaagtctgcctttaaaatggcgtatcatttgggtttggaaaac
ccctatctggcgctcaaaatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgttcatcttgtaacgcgctcagtgagagtgaggtttgtgagatttgctctgatgagagc
cgacaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaagac
ttaaaggactttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctctatattgaagacaaattacagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactcc
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system