KEGG   Helicobacter pylori HUP-B14: HPB14_05155Help
Entry
HPB14_05155       CDS       T02035                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00010  Glycolysis / Gluconeogenesis
hcn00052  Galactose metabolism
hcn00500  Starch and sucrose metabolism
hcn00520  Amino sugar and nucleotide sugar metabolism
hcn00521  Streptomycin biosynthesis
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
hcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB14_05155 (glk)
   00052 Galactose metabolism
    HPB14_05155 (glk)
   00500 Starch and sucrose metabolism
    HPB14_05155 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPB14_05155 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPB14_05155 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPB14_05155 (glk)
Enzymes [BR:hcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPB14_05155 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFI07715
UniProt: I0EXP6
Position
1086279..1087289
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacgaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgcattgaagtcttgcggtgcgaagat
tttgagagcttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacacccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcacaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgcccctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggtctggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattgaccccacaaatcattagcgaacgcgctttgaacggggat
taccctatatgccgattgaccttggacactttttgctccatgttaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttccatcccagtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcaggcattgcgttagaaaattatttactgcatgatagaatttag

DBGET integrated database retrieval system