KEGG   Helicobacter pylori HUP-B14: HPB14_05845Help
Entry
HPB14_05845       CDS       T02035                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPB14_05845
Enzymes [BR:hcn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPB14_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229373..1230527
Genome map
AA seq 384 aa AA seqDB search
MIVKRLNLDALKNALQKIGPEKIAQNHMHQKGVSFVFEIQHLPLSAVLILKQEAISVGGD
FATPRDCILAKEPFYDGVLVASANQLERLIVKCHSQPFGLKNLAQELKSHLKAKKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPESEIIDPKIEQDR
LKEILLEIKSQKLYQCAQFSIDTYHATTAQMALEHYFSILNDVSGFNSAAMLEVARDYKP
TCVLMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEILEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGIITGREVQDRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETDRTQI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccttgatgcgctcaaaaacgctctgcaaaaaataggccca
gaaaagatcgcgcaaaaccatatgcaccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgctgtgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttggtt
gcgagcgctaaccaattagaacgccttattgttaagtgccattcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccacctcaaagctaaaaaacctaacaacccacag
atcatggcaatcttgaatctcacgccggatagtttctatgaaaagagccggtttgatagt
aaaaaagcgcttgaagaaatctatcaattgctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccagagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgctcaattcagc
atagacacctaccatgccacaaccgcgcaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttaatagcgctgcaatgctagaagtcgcacgagattacaagccc
acttgcgttttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttttttaaggaaaaactagagattttagaaaaa
tacgcgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatctagccttaatcaagcatttaagccactttcttaaattcaaaaaacccctattggtg
ggagcgagccgtaaaaacacgatcgggattatcaccgggcgtgaagttcaagaccggctc
gctggcactttgagtttgcatttaatggcgctgcaaaacggagcgagtattttaagagtg
catgatattgatgagcatatcgatctcatcaaggtgtttaagagtttggaagaaacggat
cgaacccaaatttga

DBGET integrated database retrieval system