KEGG   Helicobacter pylori HUP-B14: HPB14_06070Help
Entry
HPB14_06070       CDS       T02035                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00010  Glycolysis / Gluconeogenesis
hcn00030  Pentose phosphate pathway
hcn00051  Fructose and mannose metabolism
hcn00052  Galactose metabolism
hcn00230  Purine metabolism
hcn00500  Starch and sucrose metabolism
hcn00520  Amino sugar and nucleotide sugar metabolism
hcn00521  Streptomycin biosynthesis
hcn01100  Metabolic pathways
hcn01110  Biosynthesis of secondary metabolites
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB14_06070
   00030 Pentose phosphate pathway
    HPB14_06070
   00051 Fructose and mannose metabolism
    HPB14_06070
   00052 Galactose metabolism
    HPB14_06070
   00500 Starch and sucrose metabolism
    HPB14_06070
   00520 Amino sugar and nucleotide sugar metabolism
    HPB14_06070
  Nucleotide metabolism
   00230 Purine metabolism
    HPB14_06070
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPB14_06070
Enzymes [BR:hcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPB14_06070
    5.4.2.8  phosphomannomutase
     HPB14_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFI07890
UniProt: I0EY71
Position
1273858..1275237
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNGINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLSAKHEIKPLKETPEKVNALEAYQRYLIKDFQHLKDLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYTCLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEVLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatctaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatggaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaagcgccaagcatgaaata
aaacccctaaaagaaacgccagagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggattttcagcatttaaaagatcttaaatacaaaatcgccctggattttggtaat
ggcgtgggggcgttaggattagaaccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatctagaaaaacacatgcaagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggatcgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgataggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacctttggtaagacgctcatg
tataaaaccgggcatagcaatctaaaaatcaagctcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgccctt
tacacatgtttaagggctttggagttgttgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttacaagaagtgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagggcgttgcttgggctattagaaaaactctaa

DBGET integrated database retrieval system