KEGG   Halomonas chromatireducens: LOKO_01123Help
Entry
LOKO_01123        CDS       T04292                                 

Gene name
pcaF_1
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hco  Halomonas chromatireducens
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOKO_01123 (pcaF_1)
   00630 Glyoxylate and dicarboxylate metabolism
    LOKO_01123 (pcaF_1)
   00640 Propanoate metabolism
    LOKO_01123 (pcaF_1)
   00650 Butanoate metabolism
    LOKO_01123 (pcaF_1)
  Lipid metabolism
   00071 Fatty acid degradation
    LOKO_01123 (pcaF_1)
   00072 Synthesis and degradation of ketone bodies
    LOKO_01123 (pcaF_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKO_01123 (pcaF_1)
   00310 Lysine degradation
    LOKO_01123 (pcaF_1)
   00380 Tryptophan metabolism
    LOKO_01123 (pcaF_1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOKO_01123 (pcaF_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKO_01123 (pcaF_1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LOKO_01123 (pcaF_1)
Enzymes [BR:hco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOKO_01123 (pcaF_1)
Exosome [BR:hco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOKO_01123 (pcaF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1189020..1190228
Genome map
AA seq 402 aa AA seqDB search
MHDAYIYDGLRTPFGRHGGGLAGVRPDDLLGHVLRALVARNDFAPGSYEEVLAGCTNQAG
EDSRNVARHAGLVAGLPVELAAQTINRLCGSGLAALIDAARATRLGEGELFLAGGVESMS
RAPYVLGKAESAFARNQPMYDTVIGARFPNPWIAGEFGSHSMPETADNVAHDLGIGRDAS
DAFAARSQARYAEALARGFYDDELLAIEVPQGRKQPPLVVDRDEHPRPGTDADKLGRLGA
LFDGGVVTAGNASGLNDGAAALIVGSQAAGERAGVTPRARVVASAVAGLPPRIMGLGPVP
ATQKVLERAGLSLDQMDVIEINEAFAVQVLGCVKQLGLDHDDSRLNANGGAIAIGHPLGA
SGARLALTALRQLEATGGRYALVTMCIGVGQGIATIIERLDP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgcctatatctatgacgggctacgcaccccctttggacgccatggcggcggc
cttgccggcgtccggcccgatgacctgcttggccatgtcctcagggccctggtggcccgc
aacgacttcgcgccgggctcctatgaggaggtcctggcaggctgcaccaaccaggccggc
gaggactcccgcaatgtcgctcgccatgcgggtctggttgccggcctgcccgtcgaactg
gcagctcagacgatcaaccgcctctgcggcagcggcctcgcagccctgatcgacgccgcc
cgtgccacgcgccttggcgagggggagctgttcctggccggcggcgtggaatccatgtct
cgcgcaccctatgtgctgggcaaggcggagtctgcctttgcccgcaatcagccgatgtat
gacaccgtgatcggcgctcgcttccccaacccctggatcgccggcgaattcggcagccac
agcatgcccgagaccgccgacaatgtggcccatgatctgggcataggccgtgacgcgagc
gatgcctttgccgcacgctcccaggcacgctatgccgaggccctggcccgtggcttctac
gacgacgagctgctcgccatcgaggtgcctcagggtcgcaagcaacccccgctggtggtc
gacagggacgagcacccgcgtccgggtaccgatgccgacaagctgggcaggctcggggca
ctgttcgacggcggcgtggttaccgcaggcaacgcctccgggctcaacgacggtgcagcc
gcactgatcgttggcagtcaggcagccggcgagcgggcgggagtcaccccgcgcgctcgg
gtcgtcgccagcgcggtggccggcttaccgccacgcatcatggggctggggccagtgcca
gccacccagaaggtgctggagcgcgccgggctgagcctcgatcagatggacgtcatcgag
atcaacgaagcctttgctgttcaggtcctgggctgcgtcaagcagctcggcctcgatcac
gacgacagtcgcctcaatgccaacgggggcgccattgccatcggtcacccactgggcgct
tccggcgctcgcctggcgctcaccgcactgcgccagttggaagccacgggtgggcgttat
gcgctcgtgaccatgtgtatcggggtcggccaaggcattgccaccatcatcgagcgcctt
gatccctga

DBGET integrated database retrieval system