KEGG   Halomonas chromatireducens: LOKO_03382Help
Entry
LOKO_03382        CDS       T04292                                 

Gene name
pcaF_2
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hco  Halomonas chromatireducens
Pathway
hco00071  Fatty acid degradation
hco00072  Synthesis and degradation of ketone bodies
hco00280  Valine, leucine and isoleucine degradation
hco00310  Lysine degradation
hco00362  Benzoate degradation
hco00380  Tryptophan metabolism
hco00620  Pyruvate metabolism
hco00630  Glyoxylate and dicarboxylate metabolism
hco00640  Propanoate metabolism
hco00650  Butanoate metabolism
hco00900  Terpenoid backbone biosynthesis
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01130  Biosynthesis of antibiotics
hco01200  Carbon metabolism
hco01212  Fatty acid metabolism
hco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOKO_03382 (pcaF_2)
   00630 Glyoxylate and dicarboxylate metabolism
    LOKO_03382 (pcaF_2)
   00640 Propanoate metabolism
    LOKO_03382 (pcaF_2)
   00650 Butanoate metabolism
    LOKO_03382 (pcaF_2)
  Lipid metabolism
   00071 Fatty acid degradation
    LOKO_03382 (pcaF_2)
   00072 Synthesis and degradation of ketone bodies
    LOKO_03382 (pcaF_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKO_03382 (pcaF_2)
   00310 Lysine degradation
    LOKO_03382 (pcaF_2)
   00380 Tryptophan metabolism
    LOKO_03382 (pcaF_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOKO_03382 (pcaF_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKO_03382 (pcaF_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LOKO_03382 (pcaF_2)
Enzymes [BR:hco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOKO_03382 (pcaF_2)
Exosome [BR:hco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOKO_03382 (pcaF_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt DAO_C
Motif
Other DBs
NCBI-ProteinID: AMD02426
UniProt: A0A125R0P2
Position
3602769..3603935
Genome map
AA seq 388 aa AA seqDB search
MKTRIIGVSHSRFGKLDDSLEALIADSARDALADAGVDARDIDAIYVGQFNSGMCPQEFP
ASLALQTDPELRFKPATRCENACASGSAALYQGINLIEGGLAKRVLVIGAEKMTDASPTA
IAEGLLGASYRPESQGVEAGFAGIFAQVARAYFERYGDHTDSLARIAAKNHANGVHNPLA
QLRKDLGVDFCRDVSDKNPVVAAPLKRTDCSPVSDGAAAIVLSHPDAAPTSQRQVRFRAR
AQVTDFMPLARRDLTHLEGAGRAWKQVLESAGLTLDELSLAEVHDCFTIAELMIYEAMGL
TPLGQGARAINEGWVMPDGKLPVNPSGGLKSKGHPVGATGVSMHVLAARQLLGEATGVQI
PDARLAAVFNMGGMGVASYASVLERTIG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcggatcatcggcgtatcacacagccgcttcggcaagctcgacgacagcctc
gaggctttgatcgccgactcggccagggacgccttggccgacgccggcgtcgacgcccgc
gacatcgatgccatctatgtcggacagttcaatagcggcatgtgcccacaggagtttcct
gcctccctggctctccagaccgaccctgagctgcgcttcaagcccgccacacgctgcgaa
aacgcttgcgccagcggctcggcggcactctaccagggcatcaacctgatcgagggcgga
ctggcgaaacgggtactggtcattggggccgagaagatgaccgacgcctcacccaccgcc
atcgccgagggcttgctgggtgccagttaccggcccgagtcacagggtgtcgaggccggc
tttgccggcatctttgcccaggtcgcgcgggcctacttcgagcgctacggggatcacacc
gatagcctggcccgcatcgcagccaagaatcatgccaacggcgtccacaacccgctggct
cagctacgcaaggacctgggggtcgatttctgccgcgatgtctcggacaagaacccggtc
gttgccgcgccgcttaagcgcaccgactgctcgccggtctccgatggtgccgcggccatc
gtgctgtcccaccccgacgccgcacccaccagccagcgccaggttcgcttccgcgccagg
gcccaggtcaccgacttcatgccgctggcccggcgcgacctcacccacctggaaggtgcc
ggccgggcctggaagcaggtgctggaaagcgccggcctcaccctcgacgagctatcgctg
gccgaggtacacgactgcttcaccatcgccgagttgatgatctatgaggccatggggctc
accccgctcggccagggcgcccgcgccatcaacgaaggctgggtgatgcccgacggcaag
ctgccggtcaacccctccggcggcctcaagtccaagggccacccggtcggcgccaccggg
gtatccatgcacgtcctggccgcccggcagttgctgggcgaggccacaggcgtccagatc
cccgacgcccgtctggccgccgtcttcaacatgggcggcatgggtgtggccagctacgcc
agtgtcctggagcgcaccatcggctga

DBGET integrated database retrieval system