KEGG   Helicobacter cinaedi PAGU611: HCN_0110Help
Entry
HCN_0110          CDS       T02034                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HCN_0110
Enzymes [BR:hcp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HCN_0110
Peptidases [BR:hcp01002]
 Cysteine Peptidases
  Family C44
   HCN_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(117062..118585)
Genome map
AA seq 507 aa AA seqDB search
MFHTDSDTEVVLASFAEWGEKCLHKFNGMWAFAIWNHTKQQLFLARDRFGKKPLFYSFIK
DDNGGEKLVFASEMKAIYPFLQEVKPSKKFHTLSNITHIFDYEHTSDTLIDGIYRFPYAH
YAFYSRGDKQIKPIRYYTILDYLTTPLSSYEESVEKFRALFLDSVKLRMRSDVSIGTALS
GGLDSSATICAMAYLGKNDVRKDWQHAVVACFKDTPLDESGYAKMVVDHIGIKGDFVEIE
PLKHWDKIYEYFYLFEYLYITSPVPMIAAYGVIKQKGVSVTLDGHGADELFSGYGHLIEA
LWDSKFNPAIAFDVLTTLNQTRMPASSAFALGKEAFIYYVKKTIKHLIKYKMPTSQDSNH
QNFKKLDYFSQQLYLIFSETILPTLLRNYDRYSMINSVEIRMPFMDHRLVEFIFSLPFSY
KLGKGYTKKLIRDALCPFMPPEVVWRKSKIGFNSPIIQWIQRDMAQGGLKEWFLDTTDRR
CSRNSKYTEIYHSITKRYSQSWGATMV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcacacagattctgatacagaagttgttttggcaagtttcgcagaatggggtgaa
aaatgtctccacaaattcaatggtatgtgggcatttgctatttggaatcatacaaaacaa
cagctttttcttgcccgtgatcgttttggaaaaaagccactcttttatagttttattaaa
gatgataatggcggagaaaaactcgtttttgcttctgagatgaaggcaatctatcctttt
ttacaagaagtcaaaccatcaaagaagtttcacacccttagcaatatcacacatatcttt
gactacgagcatacaagcgatacgctaattgatggaatctatcgcttcccttatgcacat
tatgccttttactcacgcggggataaacagattaagcctatccgctactacacaatcctt
gattatctcacaacgcctttgtctagctatgaagagagtgtggaaaaatttagggcattg
tttttagattctgttaaactgcgaatgcgttcagatgtgagtataggcacagctttaagc
ggtgggctagattctagtgcaacaatttgtgctatggcatatttggggaaaaatgatgta
agaaaagattggcaacacgcagttgtagcttgttttaaagatacaccccttgatgaaagt
gggtatgcaaaaatggtcgtagatcatattggtatcaagggcgattttgtggaaattgag
ccactcaagcattgggataaaatctatgaatatttttatttgtttgaatatctttatatc
acaagccctgtgcctatgattgcagcctatggggtaattaaacaaaagggagtgagcgtt
acacttgatggtcacggagcagatgagctttttagcgggtatggacatttgattgaagca
ctttgggatagcaaatttaatccagcaatcgcttttgatgttttaacaacactcaatcaa
acaagaatgcctgcaagctcggcatttgcacttggaaaagaagcctttatatattatgtc
aaaaagacaattaagcaccttatcaaatacaaaatgccaacttcacaagattcaaatcat
caaaacttcaaaaagctggattactttagccaacagctttatcttatctttagtgaaacc
attctgccaacgctcttacgaaattatgatagatattctatgattaatagcgttgaaatt
cgtatgccttttatggatcataggcttgttgagtttatatttagtctgccattctcttat
aaacttggcaaaggctatacaaaaaaactcatacgagatgcactttgtccttttatgcct
cctgaagtcgtatggagaaaaagcaaaattggatttaactcacctattattcaatggatt
caaagagatatggctcaaggtgggcttaaggagtggtttttagacacaactgatagaaga
tgcagtagaaattcaaaatacactgaaatatatcattcaatcacaaaaagatactctcaa
tcttggggagcaactatggtgtaa

DBGET integrated database retrieval system