KEGG   Helicobacter cinaedi PAGU611: HCN_0140Help
Entry
HCN_0140          CDS       T02034                                 

Definition
indole-3-glycerol-phosphate synthase
Organism
hcp  Helicobacter cinaedi PAGU611
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149822..150616
Genome map
AA seq 264 aa AA seqDB search
MKSIESNFLQSSVIFTEKCKRNLQAHLAKRKSVIDFETLGRTLAYSPFLPRFEREFFARA
RANPPKNAIRFEIQGDFDEVGFLEMASGAEQNGVRNGKHKSGGDMFLLDLRMQYMPCVSG
DCVDSKVDSSTLGMVLESISLLRRHSTLPIIHADLFVDSYQILESALFGADSLLIPCGLH
SAKTLSELLQFARRLNLEPFVEVCDKDELKRAIFSGASMLFIHKDSFEALLSLVPNSQII
ATNHHNDYGVDVQILDSGADFSSF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagcatagaatctaattttttacaatcaagcgttatttttacagaaaaatgcaaa
cgcaatcttcaagcacatttagctaaacgcaagagcgtgattgactttgagactttgggc
aggacattagcatacagcccttttctgccaagatttgagcgggaatttttcgctcgtgca
agggcaaatccacctaaaaatgctataagatttgagattcagggtgattttgatgaggtt
gggtttttggaaatggcaagtggagcggagcaaaatggcgttagaaatggcaaacataag
agtggtggagatatgtttttgcttgatttaagaatgcaatatatgccttgtgtgagtggg
gattgtgtagattctaaagtggattctagcactttgggtatggtattagaatctatctct
ttgctccgccgtcatagcactctgcctattatccacgcggatttgtttgtagattcgtat
cagattctagaatcggcgttgtttggggcggatagtctgcttatcccttgtgggttgcat
tcggctaagactttaagtgagttgctacaatttgctaggcggttaaatttagagcctttt
gttgaagtgtgtgataaagatgagctaaaaagggcgatttttagtggggcaagtatgtta
tttatacataaagattcttttgaggcacttttatcacttgtgccaaattcccaaatcatt
gctacaaatcaccacaatgattacggcgtagatgtgcagattctagatagtggggcggat
tttagctctttttaa

DBGET integrated database retrieval system