KEGG   Helicobacter cinaedi PAGU611: HCN_0140Help
Entry
HCN_0140          CDS       T02034                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCN_0140
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCN_0140
Enzymes [BR:hcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HCN_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149822..150616
Genome map
AA seq 264 aa AA seqDB search
MKSIESNFLQSSVIFTEKCKRNLQAHLAKRKSVIDFETLGRTLAYSPFLPRFEREFFARA
RANPPKNAIRFEIQGDFDEVGFLEMASGAEQNGVRNGKHKSGGDMFLLDLRMQYMPCVSG
DCVDSKVDSSTLGMVLESISLLRRHSTLPIIHADLFVDSYQILESALFGADSLLIPCGLH
SAKTLSELLQFARRLNLEPFVEVCDKDELKRAIFSGASMLFIHKDSFEALLSLVPNSQII
ATNHHNDYGVDVQILDSGADFSSF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagcatagaatctaattttttacaatcaagcgttatttttacagaaaaatgcaaa
cgcaatcttcaagcacatttagctaaacgcaagagcgtgattgactttgagactttgggc
aggacattagcatacagcccttttctgccaagatttgagcgggaatttttcgctcgtgca
agggcaaatccacctaaaaatgctataagatttgagattcagggtgattttgatgaggtt
gggtttttggaaatggcaagtggagcggagcaaaatggcgttagaaatggcaaacataag
agtggtggagatatgtttttgcttgatttaagaatgcaatatatgccttgtgtgagtggg
gattgtgtagattctaaagtggattctagcactttgggtatggtattagaatctatctct
ttgctccgccgtcatagcactctgcctattatccacgcggatttgtttgtagattcgtat
cagattctagaatcggcgttgtttggggcggatagtctgcttatcccttgtgggttgcat
tcggctaagactttaagtgagttgctacaatttgctaggcggttaaatttagagcctttt
gttgaagtgtgtgataaagatgagctaaaaagggcgatttttagtggggcaagtatgtta
tttatacataaagattcttttgaggcacttttatcacttgtgccaaattcccaaatcatt
gctacaaatcaccacaatgattacggcgtagatgtgcagattctagatagtggggcggat
tttagctctttttaa

DBGET integrated database retrieval system