KEGG   Helicobacter cinaedi PAGU611: HCN_0321Help
Entry
HCN_0321          CDS       T02034                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hcp  Helicobacter cinaedi PAGU611
Brite
Enzymes [BR:hcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HCN_0321 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_4 Methyltransf_32 Methyltransf_12 NodS Methyltransf_9 tRNA_U5-meth_tr Ubie_methyltran MTS
Motif
Other DBs
NCBI-ProteinID: BAM11632
Position
326541..327173
Genome map
AA seq 210 aa AA seqDB search
MYRKLAKKMCDEIQAKLPLSPKVIQALSSVNREIFVPPAFAHLSYEINALPMVDSQWISS
PLTVAQMTEYLAPNGGDSVLEIGCGSGYQAMVLSKMFRRVFSIERIDKLLSEARERFRAL
QVHNIFVKLDDGQKGWAEYAPFDAILFSACAREIPQGIVNQLEDGGTIVAPMLDVGRQII
KRFRKVKGVLDKGESLEECLFVDVQNGVVR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaaaactagcaaaaaaaatgtgtgatgagatacaggcaaaactcccattatcg
cccaaagttatacaagccctaagtagcgttaatcgtgaaatattcgtccctcctgctttt
gctcatctctcttatgagattaatgctttgccaatggtagattcacaatggattagctca
cctttgaccgtggctcaaatgacggaatatctcgctccaaatggtggagattctgtgctg
gagattggctgtgggagtgggtatcaagcaatggtattatcaaaaatgtttcgcagggtt
tttagcattgaacgcattgataagcttttaagtgaagcaagggagcgttttagggcgtta
caagtgcataatatctttgttaaactcgatgatgggcaaaagggctgggcggaatatgcc
ccttttgatgcaatattgttttcagcgtgtgcgagagagattccacaagggattgtgaat
cagcttgaagatggtggcactattgtcgcacctatgcttgatgtggggcgacagattatc
aagcgatttagaaaagttaaaggggttttagataagggtgaaagccttgaggagtgctta
tttgttgatgtgcaaaatggtgtggtaaggtag

DBGET integrated database retrieval system