KEGG   Helicobacter cinaedi PAGU611: HCN_0321Help
Entry
HCN_0321          CDS       T02034                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hcp  Helicobacter cinaedi PAGU611
Brite
Enzymes [BR:hcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HCN_0321 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326541..327173
Genome map
AA seq 210 aa AA seqDB search
MYRKLAKKMCDEIQAKLPLSPKVIQALSSVNREIFVPPAFAHLSYEINALPMVDSQWISS
PLTVAQMTEYLAPNGGDSVLEIGCGSGYQAMVLSKMFRRVFSIERIDKLLSEARERFRAL
QVHNIFVKLDDGQKGWAEYAPFDAILFSACAREIPQGIVNQLEDGGTIVAPMLDVGRQII
KRFRKVKGVLDKGESLEECLFVDVQNGVVR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaaaactagcaaaaaaaatgtgtgatgagatacaggcaaaactcccattatcg
cccaaagttatacaagccctaagtagcgttaatcgtgaaatattcgtccctcctgctttt
gctcatctctcttatgagattaatgctttgccaatggtagattcacaatggattagctca
cctttgaccgtggctcaaatgacggaatatctcgctccaaatggtggagattctgtgctg
gagattggctgtgggagtgggtatcaagcaatggtattatcaaaaatgtttcgcagggtt
tttagcattgaacgcattgataagcttttaagtgaagcaagggagcgttttagggcgtta
caagtgcataatatctttgttaaactcgatgatgggcaaaagggctgggcggaatatgcc
ccttttgatgcaatattgttttcagcgtgtgcgagagagattccacaagggattgtgaat
cagcttgaagatggtggcactattgtcgcacctatgcttgatgtggggcgacagattatc
aagcgatttagaaaagttaaaggggttttagataagggtgaaagccttgaggagtgctta
tttgttgatgtgcaaaatggtgtggtaaggtag

DBGET integrated database retrieval system