KEGG   Helicobacter cinaedi PAGU611: HCN_0398Help
Entry
HCN_0398          CDS       T02034                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCN_0398 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCN_0398 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HCN_0398 (thrC)
Enzymes [BR:hcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HCN_0398 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(408223..409722)
Genome map
AA seq 499 aa AA seqDB search
MSMFISTRDDNKDLGVTFQHAILNPNAPQGGLYTFFKLPLFSQEMLQSFQNLSYKQLCER
LFSSLNLNLNPNLLQQALQSYDSFDNPTNPAPLHTLSKNLFMLNLYSGPTRAFKDMALQP
FGVLLSSFAKTNKTPFMILAATSGDTGPATLQSFANKEYIKVVCLYPSGGTSDVQRLQMT
TQESKNCKVIGIKGDFDDAQSALKHLLANKDFIHKLNNLGISLSAANSVNIGRIVFQIVY
HFWAYMSAVKNGNITFGEKLSIVVPSGNFGNILGAFFAKKMGLPIHKLVVASNVNTILSD
FINTGVYDISFRHLIKSKSPAMDILKSSNVERMLYFYFGAKRTKELMENLSTQGKYSLLD
SELALVREDFSAMSCDDTQCLQSIAECFKNGYVLDPHTAIGYYVAKTLQEKGVIDKSIIL
ATAEWSKFAPSVNTALTQGQILESSQNICDEEAIKTICAKANCTISKQITDLFSKDEVQK
DVLDVAKLESCIIEWLKTF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtttatttctacgcgagatgataataaagatttaggcgttacttttcaacac
gcaatacttaatccaaatgccccacaaggcggactttatacattttttaaacttcctttg
tttagtcaagaaatgctacaaagttttcaaaatctctcatataaacaattatgcgaaagg
ctcttttcttctttgaatctcaatcttaacccaaatcttttgcaacaagccctgcaaagc
tatgatagctttgataatcctacaaatcccgccccgctccacactttaagcaaaaatctc
tttatgctcaatctctattctggtcctacacgagcttttaaggatatggctttgcaaccc
tttggtgttttactctcttcctttgccaaaacaaataaaaccccttttatgattctagct
gctacaagtggtgataccggtcctgcgacactgcaaagttttgcgaataaagaatatata
aaagttgtatgtctctacccaagtggcggcacaagtgatgtgcaaagactgcaaatgaca
acacaagaatctaaaaattgcaaggttattggcattaagggggattttgatgatgctcaa
agtgcgttaaaacatctccttgccaacaaagattttatccataagcttaacaatcttgga
atctcgctctccgctgctaattctgtgaatataggacgcattgtttttcaaattgtgtat
catttttgggcgtatatgagtgcggtaaaaaatggcaatatcacctttggagagaagcta
tccattgtcgtgcctagtgggaattttggcaatattttaggggcattttttgctaaaaaa
atgggcttacccatacacaagcttgtggttgcctctaatgtcaatactattttaagcgat
tttataaatacgggtgtatatgatatttcttttcgtcatcttatcaagtcaaaatcccca
gcaatggatattctaaaaagctcaaatgtagagcgaatgctgtatttttactttggggct
aaacgcacaaaggagctaatggagaatctctcaacgcaaggcaaatatagccttttagat
tctgaacttgctcttgtgagagaagattttagtgcgatgagttgcgatgatacacaatgt
ctgcaaagtatcgcagaatgctttaaaaatggctatgtgcttgacccacacacggctatt
ggctattatgtagcaaagacattgcaggaaaaaggcgtgatagataaaagcattatccta
gccacagcggaatggagtaaattcgccccaagtgtgaataccgctctaacacaagggcag
attctagaatcttcccaaaatatttgtgatgaagaagccattaaaacaatctgtgccaaa
gccaactgcacaatctcaaaacaaatcacagatctttttagcaaagatgaagtgcaaaaa
gatgtgcttgatgtggcaaagctagaatcttgcattatagagtggctaaagacattctaa

DBGET integrated database retrieval system