KEGG   Helicobacter cinaedi PAGU611: HCN_0403Help
Entry
HCN_0403          CDS       T02034                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCN_0403 (galU)
   00052 Galactose metabolism
    HCN_0403 (galU)
   00500 Starch and sucrose metabolism
    HCN_0403 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HCN_0403 (galU)
Enzymes [BR:hcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCN_0403 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413018..413842)
Genome map
AA seq 274 aa AA seqDB search
MIHKCLFPAAGYGTRFLPATKAMPKEMLPILTKPLIQYGVEEALESGCHNIGIVTGRGKR
SIEDHFDINYELEHQISGTDKEELLSSIRKLTDSCTFSYTRQNEMKGLGHAILTGETLIG
NEAFAVILADDLCHNAKGAGVLNQMVALYKKYRCSIVAIEEVDKNEVNKYGIIQGEEIES
GVYRVSDMIEKPSIDKAPSNLAIIGRYILTPDIFDILRVTKPGKKGEIQITDALLEQAKQ
GRVLAYKFQGKRYDCGSIDGYVKATIDFYEHFKH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatacataaatgcttatttcccgccgctgggtatggcacacgatttttacccgcaaca
aaagctatgccaaaagaaatgctccctattcttacaaagccccttattcaatatggtgta
gaagaagctttagaatctggttgccacaatatcggcattgttacagggcggggcaaacgc
agtattgaagatcattttgatataaattatgagctagaacatcaaatctctggcacagat
aaagaagaactactctctagcattaggaaactcacagattcttgcaccttttcttacaca
aggcaaaatgaaatgaaaggcttaggacacgctattttgacaggcgaaacactcattggt
aatgaagcctttgccgtaatccttgctgatgacttgtgtcataatgcaaaaggtgcaggg
gtgcttaaccaaatggtagctttatacaaaaaatatcgttgctccattgtggctattgaa
gaagtggataagaatgaagtgaataaatacggcattatccaaggtgaagagatagaatct
ggcgtgtatcgtgtaagcgatatgatagaaaaaccaagcattgataaagcccctagcaat
cttgccattattggtcgctatattttaacgcctgatatttttgatattctgcgtgttaca
aagccgggcaaaaaaggggagattcaaatcaccgatgcccttttggagcaagccaagcaa
ggcagagtattagcctataaatttcaaggcaaacgctatgactgcggaagtattgatggc
tatgtaaaagcaacaattgatttttatgagcattttaagcactag

DBGET integrated database retrieval system