KEGG   Helicobacter cinaedi PAGU611: HCN_0734Help
Entry
HCN_0734          CDS       T02034                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCN_0734 (hemB)
Enzymes [BR:hcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HCN_0734 (hemB)
Exosome [BR:hcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCN_0734 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(743329..744294)
Genome map
AA seq 321 aa AA seqDB search
MFRRLKRTRLKAPMRELVRETRLHKQDFIYPLFVIEGQNVKNEIPSMPDVFQLSVDNILK
ECEELLNIGIYHILLFGLPSHKDSCGSEALSDKSIIPQAIKAIKKHFPQMIITLDLCFCE
YTDHGHCGILDKNLNSVDNDATLEILGQQALVLASCGGDMIAPSAMMDGMVSTIRTYLDK
GGFSHIPIMSYSTKFASGYYGPFRDVANSAPSFGDRNSYQQDSANRREAILESLTDEAEG
ADILMVKPALAYLDIVRDIRDRTLLPLAVYNVSGEYAMLKHAQKANLIDYERVLFETLTG
FKRAGADIIISYHTKEIAKLL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttagacgactaaaacgcacacgcctaaaagcccctatgcgagagcttgtaagagaa
actagattacataagcaggattttatctatccgctttttgtgattgaagggcaaaatgtc
aaaaatgaaatcccctctatgccagatgtgtttcaactaagcgttgataatatccttaaa
gaatgcgaggaattactcaatattggcatataccatattctcctttttggtttgccaagc
cacaaagattcttgtggaagcgaggctttgagtgataaaagcattatcccacaagccata
aaagccataaaaaaacattttccgcagatgattatcacacttgatttatgcttttgtgaa
tacacagaccacggacattgtggaatcttagataagaatcttaatagtgtagataatgac
gccacacttgagattctagggcaacaagccttagtccttgcaagttgcggtggggatatg
atagccccaagtgcgatgatggacggaatggtaagcacaatacgcacctatttagataaa
ggcggattctctcatatccccattatgagctactctactaaatttgcaagtggctattat
ggaccattccgcgatgtggcaaactccgctccaagctttggcgatagaaactcttatcag
caagatagtgctaatcgcagggaagctattttagagagcctaaccgatgaagctgaagga
gcggatattttaatggtaaaaccagccctagcctatttagacattgtgcgtgatattcgc
gaccgcactttgctgcctttagctgtgtataatgttagcggggagtatgctatgctaaaa
cacgcgcaaaaagccaatcttattgactatgaacgcgttttatttgaaacactcacaggc
tttaagcgtgcgggagcggatattatcattagctatcacactaaagagatagctaaactt
ctttag

DBGET integrated database retrieval system