KEGG   Helicobacter cinaedi PAGU611: HCN_0879Help
Entry
HCN_0879          CDS       T02034                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hcp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hcp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890453..891754
Genome map
AA seq 433 aa AA seqDB search
MKILDTHTCEFDKEFAKILERGKMDMGEVSSIVQSILEEIKNEGFGALQRHIARFDKWEA
KSLQDLQISQTQCAKAYDDLPKDLKNALHLAYDRIYAFHQKQKQQTWIDCELNGTMLGSK
LTPMERAGLYIPGGKAAYPSSVLMNAIPAIVAGVKEIVLCSPAPHNELNPLLLAALHLCN
ITESYKVGGASAIGLMAYGIDGVKKADVITGPGNIFVACAKKLVFGEVNIDMVAGPSEIA
IIADKSANPQYVAYDLLSQAEHDEMASSILISDDIGLIEKVKAQIDEILPTMPRYEIAKK
SIENRSVLIYTRDINESIEIANALAAEHLEILTHSPFDVLPYIKHAGAIFLGEYSSEPIG
DYLAGPNHTLPTGGSARFFSPLSVEHFMKRSSIISFSRNALKQMGESCAILAECESLHAH
AQAVLKRLDSIKE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccttgatacgcatacttgtgagtttgataaagaatttgcaaagattctagag
cgtggcaagatggatatgggagaggtttcatctatcgtgcagagtatccttgaagagata
aaaaatgaaggttttggagctttgcaaaggcatattgctcgttttgataagtgggaagca
aaaagtttgcaggatttgcaaatctctcaaacgcagtgtgccaaagcctatgatgatttg
ccaaaagatttaaaaaatgctctgcatttagcctatgatagaatctacgcctttcatcaa
aagcaaaaacagcaaacttggattgattgtgagctaaatggcactatgcttggatccaag
cttacacctatggagcgtgcggggctatatatccccggtggcaaggctgcctacccaagc
tcggtgcttatgaatgcaatccctgctattgttgctggtgttaaggagattgtgctttgt
tctcctgctccacataatgagcttaatccacttcttttagcagccctgcatttatgtaat
attacagaatcttataaagtcggtggggcaagtgccatagggcttatggcgtatgggatt
gatggggtgaaaaaggcagatgttatcacaggtccgggcaatatttttgtcgcttgtgcg
aagaagcttgtgtttggtgaagttaatattgatatggtggcaggtcctagtgaaatagcc
ataatcgccgataagagtgcaaacccgcaatatgtggcttatgatttactctctcaagct
gaacacgatgaaatggcaagctccattcttataagcgatgatataggcttgattgaaaag
gtaaaagcacagatagatgagattctgcctacaatgcctcgctatgagattgctaaaaaa
agcattgaaaatcgttccgttttgatatatacgcgtgatataaatgaaagcatagaaata
gcaaatgctctagcggctgaacatttggagattctaacgcattcaccttttgatgtattg
ccttatatcaaacacgctggagcgatatttttaggggagtattcaagtgagcctattggc
gattatctcgctggtcccaaccatacgctgccaacgggtggtagtgcgagattcttttct
cctttgagcgtggagcattttatgaaaagaagctctattatctcattttcacgcaatgcg
ttaaagcaaatgggagaatcttgtgcgattttagcagaatgtgaatctctccacgctcac
gcacaagcagttttaaaaagactagattctataaaggagtag

DBGET integrated database retrieval system