KEGG   Helicobacter cinaedi PAGU611: HCN_0980Help
Entry
HCN_0980          CDS       T02034                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hcp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hcp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000598..1001761
Genome map
AA seq 387 aa AA seqDB search
MPLSLLKDLVKLPSITPQECGIYTMIKEKFSQIQTPLLESLVIEQENNGVKNLFYLFYPK
GADISALPHLCFAGHIDVVPTGESWQYEPFSAKEVDGYIYGRGTQDMKGGVSAFVSAICQ
SLESQSLENCMLSILLTSDEEGEGTYGTKIMLETLQKRHLLPHCCIVAEPTSTHHTGDTI
KIGRRGSINGTLIIEGKQGHAAYPQKCLNPIELLGSRLGFLAGVNLDNGNSYFEPSKLVI
TDIRGGMEVVNVTPQNLKIMFNVRNSPLSDESSIRIYVESTLATLPYTLTLKTSSLPFIT
ESNTELVKSLNAVIEAKVGKKAELSTSGGTSDARFFSAFGVKVVELGVPNDRIHAINERV
KIDDILILHDIFIDFLAIFKNSAKKFV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgtcattattaaaagatttagtcaagctccctagcatcaccccgcaggaatgt
ggaatctacactatgattaaagaaaaatttagccagattcaaaccccgcttttagaaagc
cttgtcattgagcaggaaaataatggtgtgaaaaatcttttttaccttttctatccaaag
ggggctgatataagtgcattgccccatttatgctttgctgggcatattgatgtcgtcccc
acaggggaaagttggcagtatgaaccattctctgctaaagaagtagatggatatatctat
ggcaggggaacacaggatatgaaaggcggtgtgagtgcgtttgtgagtgcaatttgccaa
agtttagaatctcaaagccttgaaaattgtatgctctctatcctacttacaagcgatgaa
gaaggggaaggaacttatggcacaaaaattatgctagaaacgctacaaaaacgccactta
ctgccccattgctgtattgtcgccgagcctacaagcacacatcacacaggcgatacgata
aaaatcgggcgtcgcggatccattaatggcacactcatcattgaaggcaaacaagggcat
gccgcctatccgcaaaaatgtcttaatcccatagaattgcttgggagcagacttgggttt
ttggctggagtgaatcttgataatggcaatagctattttgaaccaagcaaacttgtgata
accgatattcgcgggggtatggaggttgtgaatgtaacaccgcagaatcttaaaataatg
tttaatgtaagaaattcccctttaagtgatgaatcttctatccgcatatatgtagaatct
actcttgctacactgccctatacgctgacactcaaaacaagctctctgccctttatcact
gaaagcaacacagagcttgtaaaatcactcaatgccgtgattgaagcaaaggtgggtaaa
aaggcggagcttagcacaagcggtgggacaagcgatgcgagatttttctctgcttttggt
gtcaaagtggtagaacttggcgtcccaaatgatagaatccacgccatcaatgagcgagta
aaaatagatgatattctcatactgcacgatattttcattgattttctagcaatttttaaa
aatagtgctaaaaaatttgtttga

DBGET integrated database retrieval system