KEGG   Helicobacter cinaedi PAGU611: HCN_1045Help
Entry
HCN_1045          CDS       T02034                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCN_1045 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCN_1045 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCN_1045 (trpB)
Enzymes [BR:hcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCN_1045 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1058750..1060009)
Genome map
AA seq 419 aa AA seqDB search
MAKVFTESKNGYFGEAKGGKHAFGGQYVPEILLPALKELEKAYRGVFLSKGYKKELKSLL
KHFVGRPTPLIYAKNASKILNNEIYLKFEGLANTGAHKINNALGQVLLAKYMGKKRVIAE
TGAGQHGLATAAACAKLGLECEIFMGEIDIARQHPNVFNMELFGAKVQSVSSGSKTLKDA
VNEALREWSKRSEDSFYVLGSAVGPYPYPDLVRDLQSVISKELKKQTKAYFSGLPDIMIA
CVGGGSNAMGFFAHYLKENVKLIGVEAGGKGNGIGENAIRINAINASEGIAQGYKSLFLQ
DEDGQLSHTHSISAGLDYAGIGPQLAHLYEANRLHFTSATDDEALEALTFFAKNEGIIPA
LESSHALAALLKVCKENKGKKIIANVSGRGDKDIFITAKALTPTQWKNFLKDEIKRIES
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtttttacagaatctaaaaatggttattttggtgaagcaaaaggtggcaaa
cacgcttttggcggacaatatgtcccagagattctgcttccagcactcaaagagttggag
aaagcctatcgcggcgtgtttcttagcaaagggtataaaaaggagctaaaaagtctgtta
aagcactttgtaggacgacccacaccgcttatttatgccaaaaatgcctctaagattcta
aataacgagatttatcttaagtttgaaggcttggcaaacacaggcgcacacaagattaat
aacgccctaggacaagtgcttttggcaaaatatatggggaaaaagcgcgtgattgctgaa
accggtgcgggacagcacggcttagccacagcggcggcttgtgcgaagcttgggctagaa
tgcgaaatctttatgggggagattgacatcgcaagacagcatccaaatgtctttaatatg
gagctttttggggcaaaagtacagagtgtcagtagcgggagcaaaacgcttaaagatgcg
gtgaatgaagcgttgcgagagtggagtaaaagaagcgaagatagcttttatgtgctaggc
agtgcggttggtccttatccttaccctgatcttgtacgggatttacaaagcgtgattagc
aaggagctaaaaaagcagacaaaggcttattttagcggactgcctgatattatgatagct
tgtgttggtggcggaagtaatgctatgggcttttttgcacattatttgaaagaaaatgtc
aagcttataggcgttgaggctgggggcaaggggaatggcattggcgaaaatgctattagg
attaatgctataaatgcaagtgaaggcatagctcaaggctacaaaagcctatttttacaa
gatgaggacgggcagcttagtcatacgcattctatttctgcagggcttgattatgctggg
attggaccgcaactcgcacatttatatgaagccaatcgtttgcattttacttccgctaca
gatgatgaagcactagaagcattaacattttttgctaagaatgagggcattatccccgct
ttagagtctagccacgcccttgctgcattacttaaagtatgcaaagagaataaaggcaaa
aaaatcattgcaaatgtgtcaggcaggggtgataaagatattttcatcacagcaaaagcc
ctaacaccaacgcaatggaaaaactttttaaaagatgagataaagcggattgagagctag

DBGET integrated database retrieval system