KEGG   Helicobacter cinaedi PAGU611: HCN_1046Help
Entry
HCN_1046          CDS       T02034                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCN_1046 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCN_1046 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCN_1046 (trpA)
Enzymes [BR:hcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCN_1046 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1060147..1060944
Genome map
AA seq 265 aa AA seqDB search
MSKNKQTQLMGHIIAGYPTLELSMYAALGIAHAGANYLEVQFPFSDPNADGVVIEEACDK
SLAQGFKVTQGFSLLQALSSRLAHTQSKDKTTRLIVMTYANLIFRYGVEEFIKEAKECGA
WGMIVPDLPLESDEKLRILAQKYEINIISLIAPKTKASRIKKIAKASDEIVYIVSRSGTT
GSKTHIDSTLLEWLKFIRRFCKKPLALGFGINSNEQVEMLKNNVEIIVAGSYFVRFITEL
SKESKLTPQDYLHKLQEHTKALMGW
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaataagcaaactcagcttatggggcatattatcgctgggtatcctaccttg
gagctaagtatgtatgccgcgcttgggattgcccacgctggggcaaactaccttgaagtg
cagtttccattttctgatccaaatgccgatggcgtagtgattgaagaggcttgtgataaa
agcctagctcaaggttttaaagttacacagggcttttccttgcttcaagcactttcttca
cgcctagcccatacgcagagtaaggataaaacaacgcgtcttattgtgatgacttatgcg
aatttgatttttcgctatggtgttgaagagtttatcaaagaggcaaaggaatgtggggcg
tggggtatgatagtccctgatttgcctttagaatctgatgaaaaactccgcattttagct
caaaaatatgagattaacatcatctcgcttattgcccccaaaaccaaggcttcacggatt
aagaaaatcgctaaagcaagtgatgagattgtctatatcgtctctcgctctgggactacg
ggatcaaaaacgcatatagattctacacttttagagtggcttaagtttatacgcagattc
tgtaaaaagcctttggcactgggctttgggataaatagcaatgaacaggttgaaatgcta
aaaaataatgttgagattatcgtggctggaagctattttgtgcggtttatcaccgaatta
tctaaagaatctaagctcactccgcaggattatctccacaagttgcaagagcatacaaaa
gcccttatgggttggtag

DBGET integrated database retrieval system