KEGG   Helicobacter cinaedi PAGU611: HCN_1794Help
Entry
HCN_1794          CDS       T02034                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HCN_1794
Enzymes [BR:hcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HCN_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1778071..1778700
Genome map
AA seq 209 aa AA seqDB search
MNIHTTQVSQELIQNIANVSLSLFRKNFFGIFHGAISARVSKNRFIINKQNAIFDNINAD
SMIMLYQKQDYRWNEASLHAPIHAAIYESFSEAKFIAYAMPPYLVSYTLKYDKLEPKDYF
GYKFLAPSVEIFDPKDYESWAERADTDIPRYFKEHSHSFMLIKGYGVYVYARDLHTLAKI
IALIENSCKILHYNADLGEIFETSAKYDV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccataccactcaagtaagccaggagcttatacaaaacatcgctaatgtctct
ctttcactctttaggaagaacttttttggaatctttcacggggcgatttctgcgcgtgtg
agtaaaaaccgctttattatcaacaaacaaaatgctatttttgacaatatcaacgcagat
tctatgattatgctctatcaaaagcaggactatcgctggaatgaggcaagtctgcacgcc
cccattcacgcagcaatttatgagagcttttctgaagcaaagtttatcgcctatgctatg
ccgccttatcttgtgtcttatacgcttaaatacgacaagctagagccaaaggattatttt
ggatataaatttttagccccgagtgttgagatttttgaccctaaggattatgagagctgg
gcggaacgcgctgatacggatattccacgatattttaaggagcattcccatagctttatg
ctgattaaaggctatggcgtgtatgtgtatgctagggatttacacacattagccaagatt
attgccttaattgaaaattcgtgtaagattctgcattacaacgccgatttgggcgagatt
tttgaaacgagtgcgaaatatgatgtctaa

DBGET integrated database retrieval system