KEGG   Helicobacter cinaedi PAGU611: HCN_1868Help
Entry
HCN_1868          CDS       T02034                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hcp  Helicobacter cinaedi PAGU611
Brite
Enzymes [BR:hcp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HCN_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1854358..1855467
Genome map
AA seq 369 aa AA seqDB search
MKNFLHNSRHKTIAIVCVLGISSAYAMPKNIQALRKMYLSPKSQWQKPQVDSSVLWEELS
ALPDTPPYPESNPYSLAKAKLGERLFFDPILSQSKQIACATCHDKELGFADGRSVSYGHN
RQLGKRNAPSVVMSAFGKEKFWDGRAKDLESQALFPIADPKEMAYSPQKAVKRLAKDASY
KAMFKEAFGSDEITTERLAQAIATYERTLMPKNSRFDKFMKGQSQALSDKEVWGLHLFRT
KARCMNCHYGASFSDESFHNLGLTYYGRKYEDLGLFHTTGNTEDIGKFKTPSLRNVVKTA
PYMHNGLFPHLRGVLNAYNGGMFHPNANTKELEDKTRKNLPYPKTDLLLKPLNLSSDEIQ
ALEAFLKTL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaactttttacataatagcagacacaagacaatcgcaatcgtttgtgtgcttggc
ataagctcagcctatgctatgccaaaaaatatacaagccctgcgaaaaatgtatctctct
cccaaatctcaatggcaaaagccacaagtagattctagtgtgttgtgggaagagctatcc
gccctgccagatacaccgccctatccagaatctaatccctattcattagctaaagcaaag
cttggggaaaggctcttttttgaccctatcctctctcaaagcaaacaaattgcttgtgcc
acttgccacgataaagaactaggctttgccgatgggcgaagcgtaagctatggacataat
cgccaactaggcaaacgcaacgcaccaagcgttgtaatgtcagcatttggaaaggaaaag
ttttgggacgggagggcaaaagacttagaatctcaagctctttttcccatagctgaccca
aaggaaatggcgtattccccacaaaaagcagtcaaaagattggctaaagatgctagttat
aaagcgatgtttaaagaggcttttgggagtgatgagattaccacggagcgtttagcccaa
gctatcgccacttatgagcgaacgcttatgccaaaaaatagccgttttgataaatttatg
aaagggcaatcccaagccctaagcgataaggaagtatgggggctacatctcttccgcact
aaagctcgttgtatgaactgccattatggagcgagttttagcgatgagagttttcacaat
ctggggctcacctactatggaagaaaatatgaggatttaggcttgtttcacactacgggc
aacacagaggatataggcaagtttaaaacgccaagccttagaaatgtagtcaaaacagca
ccctatatgcacaatgggctttttccacatctgcgtggagtgctgaatgcctataatgga
ggaatgttccacccaaatgcaaacaccaaagagctagaagataaaacaaggaaaaatctc
ccctaccctaagacagatttacttctaaagccgctaaacttaagtagtgatgagattcaa
gcacttgaggcattcttaaaaacactctaa

DBGET integrated database retrieval system