KEGG   Helicobacter cinaedi PAGU611: HCN_1901Help
Entry
HCN_1901          CDS       T02034                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCN_1901 (tpiA)
   01230 Biosynthesis of amino acids
    HCN_1901 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCN_1901 (tpiA)
   00051 Fructose and mannose metabolism
    HCN_1901 (tpiA)
   00562 Inositol phosphate metabolism
    HCN_1901 (tpiA)
Enzymes [BR:hcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HCN_1901 (tpiA)
Exosome [BR:hcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HCN_1901 (tpiA)
  Exosomal proteins of bladder cancer cells
   HCN_1901 (tpiA)
  Exosomal proteins of melanoma cells
   HCN_1901 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1888555..1889277)
Genome map
AA seq 240 aa AA seqDB search
MKTIIAGNFKANLTRKQVAAYTQGLEKFLESQCADSIKNHKLQVDIFPSYTALLEDNFKH
FHIGTQNGYFALSGGFTGEIGLLQLQEFEIHRILIGHSERRNLLGENSECIAKKFRFYAE
AGFEIYYCIGEDLQTREKGEEALKNFLNAQLANIDVSYPKLVVAYEPIWAIGTGVSAKAE
QIAKTHKILAEMTQAPLLYGGSVNADNAGEILKIPNVSGVLVGSASLEMESFAKIIKSAL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattattgctgggaactttaaggcaaatctaacgcgaaagcaggtggcggct
tatacgcaaggattagagaagtttttagaatctcaatgtgcagattctattaaaaatcat
aagctacaagtggatattttcccctcatacacggcgttacttgaggataattttaagcat
tttcacattggcacacaaaatggctattttgctctatctggaggttttacgggcgaaatt
gggcttttacaattacaagaatttgagattcatcgtattttgattgggcatagtgagcgt
aggaatctgcttggtgaaaatagtgaatgtattgccaaaaagtttagattctatgctgaa
gcgggatttgagatttattactgcataggggaggatttgcaaacgcgtgaaaaaggcgaa
gaagcgttaaagaactttttgaatgcacaacttgcaaacattgatgtaagttatcctaaa
ctggttgtagcctatgaacctatttgggcgattggcacgggggtaagtgcaaaggcggag
cagattgcaaaaacacataagattctagcggagatgacacaagctccattgctgtatggc
gggagtgtgaatgcggataatgcgggggaaattctaaagattccaaatgtaagtggtgtg
cttgtaggctcggcaagtttggaaatggaaagctttgctaagattattaaatctgcactt
tag

DBGET integrated database retrieval system