KEGG   Helicobacter cinaedi PAGU611: HCN_2069Help
Entry
HCN_2069          CDS       T02034                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hcp  Helicobacter cinaedi PAGU611
Brite
Enzymes [BR:hcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HCN_2069
Secretion system [BR:hcp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HCN_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2048109..2048849
Genome map
AA seq 246 aa AA seqDB search
MKKILLSLSLISSFVSSLALAANFEQTLQETIKYSTKQNAKILKIQDLKSTPNIKLVLIE
VGKMQVPIFASGDGRAVIGVSNVFFSSNNEDMGAVGSLIKQTQNDTPDDEKLSKFFKQIP
KDDYIILESKNKNSKKITYIISDPNCPSCQKELKNIDKHLADSNVYMLIVGFVGKDSPLK
ASMLRERAADMKDNKQKLALLQEVYTPNSKVPSSFINIDIKDTMRLNQKTMEAGIKSVPF
IFESEK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattcttctctctcttagccttatctctagctttgtttctagtcttgctttg
gcggcgaattttgagcaaaccctgcaagagacaatcaaatatagcaccaaacaaaacgca
aaaatcctaaaaatccaagatcttaaatccacgccaaacattaaactcgtgctgattgaa
gtaggcaaaatgcaagtgccgatttttgcaagtggcgatggacgggcggttataggtgtg
tcaaatgtctttttctctagcaataatgaggatatgggagcggtaggctcactcattaag
caaacacaaaacgacacccccgatgatgaaaagctaagcaaattttttaagcagattcca
aaagatgactacatcattttagaatctaaaaacaaaaatagtaaaaaaatcacctacatt
atctccgatcccaactgcccaagctgtcaaaaagagctaaaaaacattgataaacaccta
gcagattctaatgtctatatgctgattgtgggctttgtgggtaaagattcacctttgaag
gcaagtatgctacgagaaagggcagctgatatgaaagataataagcaaaaactcgccctt
ttgcaagaagtctatacaccaaattccaaagtgccttcaagctttattaatattgatatc
aaagacacaatgcgtcttaatcaaaagactatggaagcaggcattaaaagtgtgcctttt
atttttgagagtgaaaaataa

DBGET integrated database retrieval system